Anti-OX40 antibodies and methods of use

US9975957B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-9975957-B2
Application numberUS-201514673792-A
CountryUS
Kind codeB2
Filing dateMar 30, 2015
Priority dateMar 31, 2014
Publication dateMay 22, 2018
Grant dateMay 22, 2018

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The invention provides anti-OX40 antibodies and methods of using the same.

First claim

Opening claim text (preview).

What is claimed is: 1. An antibody that binds human OX40, wherein the antibody comprises: (1) a heavy chain variable domain (VH) comprising (a) an HVR-H1 comprising the amino acid sequence of DSYMS (SEQ ID NO:2); (b) an HVR-H2 comprising the amino acid sequence of DMYPDNGDSSYNQKFRE (SEQ ID NO:3); and (c) an HVR-H3 comprising the amino acid sequence of APRWYFSV (SEQ ID NO:4); and (2) a light chain variable domain (VL) comprising (d) an HVR-L1 comprising the amino acid sequence of RASQDISNYLN (SEQ ID NO:5); (e) an HVR-L2 comprising the amino acid sequence of YTSRLRS (SEQ ID NO:6); and (f) an HVR-L3 comprising the amino acid sequence of QQGHTLPPT (SEQ ID NO:7). 2. The antibody of claim 1 , wherein the antibody is a monoclonal antibody. 3. The antibody of claim 1 , wherein the antibody is a humanized antibody. 4. An antibody that binds human OX40, wherein the antibody comprises: (1) a heavy chain variable domain (VH) comprising the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGYTFTDSYMSWVRQAPGQGLEWIGDMYPDNGDSS YNQKFRERVTITRDTSTSTAYLELSSLRSEDTAVYYCVLAPRWYFSVWGQGTLVTVSS (SEQ ID NO:56); and (2) a light chain variable domain (VL) comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYYTSRLRSGVPSRF SGSGSGTDFTLTISSLQPEDFATYYCQQGHTLPPTFGQGTKVEIK (SEQ ID NO:57). 5. The antibody of claim 4 , wherein the antibody is a monoclonal antibody. 6. An antibody that binds human OX40, wherein the antibody comprises: (1) a heavy chain variable domain (VH) comprising the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGYTFTDSYMSWVRQAPGQGLEWIGDMYPDNGDSS YNQKFRERVTITRDTSTSTAYLELSSLRSEDTAVYYCVLAPRWYFSVWGQGTLVTVSS (SEQ ID NO:56); (2) a light chain variable domain (VL) comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYYTSRLRSGVPSRF SGSGSGTDFTLTISSLQPEDFATYYCQQGHTLPPTFGQGTKVEIK (SEQ ID NO:57); and (3) a human IgG1 Fc region. 7. The antibody of claim 6 , wherein the antibody is a monoclonal antibody. 8. An immunoconjugate comprising an antibody that binds human OX40, wherein the antibody is conjugated to a cytotoxic agent or label, and wherein the antibody comprises: (1) a heavy chain variable domain (VH) comprising (a) an HVR-H1 comprising the amino acid sequence of DSYMS (SEQ ID NO:2); (b) an HVR-H2 comprising the amino acid sequence of DMYPDNGDSSYNQKFRE (SEQ ID NO:3); and (c) an HVR-H3 comprising the amino acid sequence of APRWYFSV (SEQ ID NO:4); and (2) a light chain variable domain (VL) comprising (d) an HVR-L1 comprising the amino acid sequence of RASQDISNYLN (SEQ ID NO:5); (e) an HVR-L2 comprising the amino acid sequence of YTSRLRS (SEQ ID NO:6); and (f) an HVR-L3 comprising the amino acid sequence of QQGHTLPPT (SEQ ID NO:7). 9. The immunoconjugate of claim 8 , wherein: (1) the heavy chain variable domain (VH) comprises the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGYTFTDSYMSWVRQAPGQGLEWIGDMYPDNGDSS YNQKFRERVTITRDTSTSTAYLELSSLRSEDTAVYYCVLAPRWYFSVWGQGTLVTVSS (SEQ ID NO:56); and (2) the light chain variable domain (VL) comprises the amino acid sequence of DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYYTSRLRSGVPSRF SGSGSGTDFTLTISSLQPEDFATYYCQQGHTLPPTFGQGTKVEIK (SEQ ID NO:57). 10. The immunoconjugate of claim 9 , wherein the antibody further comprises a human IgG1 Fc region. 11. The immunoconjugate of claim 8 , wherein the label is selected from the group consisting of a fluorescent label, a chromophoric label, an electron-dense label, a chemiluminescent label, a radioactive label, an enzyme, and a ligand. 12. The immunoconjugate of claim 9 , wherein the label is selected from the group consisting of a fluorescent label, a chromophoric label, an electron-dense label, a chemiluminescent label, a radioactive label, an enzyme, and a ligand. 13. The immunoconjugate of claim 10 , wherein the label is selected from the group consisting of a fluorescent label, a chromophoric label, an electron-dense label, a chemiluminescent label, a radioactive label, an enzyme, and a ligand. 14. The immunoconjugate of claim 8 , wherein the cytotoxic agent is selected from the group consisting of a radioactive isotope, a chemotherapeutic agent, and an antibiotic. 15. The immunoconjugate of claim 9 , wherein the cytotoxic agent is selected from the group consisting of a radioactive isotope, a chemotherapeutic agent, and an antibiotic. 16. The immunoconjugate of claim 10 , wherein the cytotoxic agent is selected from the group consisting of a radioactive isotope, a chemotherapeutic agent, and an antibiotic. 17. A composition comprising an antibody that binds human OX40 and a pharmaceutically acceptable carrier, wherein the antibody comprises: (1) a heavy chain variable domain (VH) comprising (a) an HVR-H1 comprising the amino acid sequence of DSYMS (SEQ ID NO:2); (b) an HVR-H2 comprising the amino acid sequence of DMYPDNGDSSYNQKFRE (SEQ ID NO:3); and (c) an HVR-H3 comprising the amino acid sequence of APRWYFSV (SEQ ID NO:4); and (2) a light chain variable domain (VL) comprising (d) an HVR-L1 comprising the amino acid sequence of RASQDISNYLN (SEQ ID NO:5); (e) an HVR-L2 comprising the amino acid sequence of YTSRLRS (SEQ ID NO:6); and (f) an HVR-L3 comprising the amino acid sequence of QQGHTLPPT (SEQ ID NO:7). 18. The composition of claim 17 , wherein the composition comprises a buffer, a surfactant, and a saccharide. 19. The composition of claim 18 , wherein the composition comprises 10 mg/mL-100 mg/mL antibody, 0.01%-0.1% (w/v) surfactant, 100 mM-320 mM saccharide, 1 mM-50 mM histidine buffer, and has a pH of 5.0-6.0. 20. The composition of claim 18 , wherein the composition comprises 10 mg/mL-100 mg/mL antibody, 0.01%-0.1% (w/v) surfactant, 100 mM-150 mM saccharide, 1 mM-25 mM histidine buffer, and has a pH of 5.0-6.0. 21. The composition of claim 18 , wherein the composition comprises 50 mg/mL-75 mg/mL antibody, 0.01%-0.1% (w/v) surfactant, 110 mM-130 mM saccharide, 20 mM-30 mM histidine buffer, and has a pH of 5.0-6.0. 22. The composition of claim 18 , wherein the composition comprises 10 mg/mL-100 mg/mL antibody, 0.02%-0.06% (w/v) polysorbate, 100 mM-320 mM sucrose, 1 mM-50 mM histidine buffer, and has a pH of 5.0-6.0. 23. The composition of claim 18 , wherein the composition comprises 60 mg/mL antibody, 0.03% (w/v) polysorbate, 120 mM sucrose, 20 mM histidine acetate buffer, and has a pH of 5.5. 24. A composition comprising an antibody that binds human OX40 and a pharmaceutically acceptable carrier, wherein the antibody comprises: (1) a heavy chain variable domain (VH) comprising the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGYTFTDSYMSWVRQAPGQGLEWIGDMYPDNGDSS YNQKFRERVTITRDTSTSTAYLELSSLRSEDTAVYYCVLAPRWYFSVWGQGTLVTVSS (SEQ ID NO:56); and (2) a light chain variable domain (VL) comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYYTSRLRSGVPSRF SGSGSGTDFTLTISSLQPEDFATYYCQQGHTLPPTFGQGTKVEIK (SEQ ID NO:57). 25. The composition of claim 24 , wherein the composition comprises a buffer, a surfactant, and a saccharide. 26. The composition of claim 25 , wherein the composition comprises 10 mg/mL-100 mg/mL antibody, 0.01%-0.1% (w/v) surfactant, 100 mM-320 mM saccharide, 1 mM-50 mM histidine buffer, and has a pH of 5.0-6.0. 27. The composition of claim 25 , wherein the composition comprises 10 mg/mL-100 mg/mL antibody, 0.01%-0.1% (w/v) surfactant, 100 mM-150 mM saccharide, 1 mM-25 mM histidine buffer, and has

Assignees

Inventors

Classifications

  • Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title

  • Antineoplastic agents · CPC title

  • Vectors or expression systems specially adapted for eukaryotic hosts · CPC title

  • Cells modified by introduction of foreign genetic material · CPC title

  • General methods for preparing the vector, for introducing it into the cell or for selecting the vector-containing host · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US9975957B2 cover?
The invention provides anti-OX40 antibodies and methods of using the same.
Who is the assignee on this patent?
Genentech Inc
What technology area does this patent fall under?
Primary CPC classification C07K16/2878. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue May 22 2018 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 12 related publications on this page (citations in our corpus or others sharing the same primary CPC).