Antibody molecules to pd-l1 and uses thereof
US-2016108123-A1 · Apr 21, 2016 · US
Anti-OX40 antibodies and methods of use
US10730951B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10730951-B2 |
| Application number | US-201815951082-A |
| Country | US |
| Kind code | B2 |
| Filing date | Apr 11, 2018 |
| Priority date | Mar 31, 2014 |
| Publication date | Aug 4, 2020 |
| Grant date | Aug 4, 2020 |
How to read this patent
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
- Title
What the patent document calls the invention.
- Abstract
A short plain-language summary of the technical disclosure.
- Assignees and inventors
Who owns or filed the patent and who is credited as inventor.
- Key dates
Filing, priority, publication, and grant dates set the timeline.
- First independent claim
The legal scope of protection — read this for what is actually claimed.
- CPC / IPC classifications
Technology tags used to group this patent with similar filings.
- Citations and related patents
Prior art links and similar publications in this corpus.
Abstract
Official abstract text for this publication.
The invention provides anti-OX40 antibodies and methods of using the same.
First claim
Opening claim text (preview).
What is claimed is: 1. An isolated nucleic acid encoding an anti-human OX40 agonist antibody, wherein the antibody comprises: (1) a heavy chain variable domain (VH) comprising (a) an HVR-H1 comprising the amino acid sequence of DSYMS (SEQ ID NO:2); (b) an HVR-H2 comprising the amino acid sequence of DMYPDNGDSSYNQKFRE (SEQ ID NO:3); and (c) an HVR-H3 comprising the amino acid sequence of APRWYFSV (SEQ ID NO:4); and (2) a light chain variable domain (VL) comprising (d) an HVR-L1 comprising the amino acid sequence of RASQDISNYLN (SEQ ID NO:5); (e) an HVR-L2 comprising the amino acid sequence of YTSRLRS (SEQ ID NO:6); and (f) an HVR-L3 comprising the amino acid sequence of QQGHTLPPT (SEQ ID NO:7). 2. The isolated nucleic acid of claim 1 , wherein the antibody is a humanized antibody. 3. The isolated nucleic acid of claim 1 , wherein the antibody comprises: (1) a heavy chain variable domain (VH) comprising the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGYTFTDSYMSWVRQAPGQGLEWIGDMYPDNG DSSYNQKFRERVTITRDTSTSTAYLELSSLRSEDTAVYYCVLAPRWYFSVWGQGTLVTV SS (SEQ ID NO:56); and (2) a light chain variable domain (VL) comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYYTSRLRSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQGHTLPPTFGQGTKVEIK (SEQ ID NO:57). 4. The isolated nucleic acid of claim 3 , wherein the antibody further comprises a human IgG1 Fc region. 5. An isolated host cell comprising the nucleic acid of claim 1 . 6. A method of producing an antibody comprising culturing the host cell of claim 5 so that the antibody is produced. 7. The method of claim 6 , further comprising recovering the antibody from the host cell.
Assignees
Inventors
Classifications
Antineoplastic agents · CPC title
Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates · CPC title
Complete heavy chain or Fd fragment, i.e. VH + CH1 · CPC title
comprising antibodies · CPC title
Reproductive system, e.g. ovaria, uterus, testes, prostate · CPC title
Patent family
Related publications grouped by family.
External sources
Frequently asked questions
Answers are generated from the same data shown on this page.
- What does patent US10730951B2 cover?
- The invention provides anti-OX40 antibodies and methods of using the same.
- Who is the assignee on this patent?
- Genentech Inc
- What technology area does this patent fall under?
- Primary CPC classification C07K16/2878. Mapped technology areas include Chemistry & Metallurgy.
- When was this patent published?
- Publication date Tue Aug 04 2020 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
- What related patents are in patentsdb?
- We list 12 related publications on this page (citations in our corpus or others sharing the same primary CPC).