Anti-tau antibody and uses thereof

Patent metadata

Field	Value
Publication number	US-10098973-B2
Application number	US-201515518069-A
Country	US
Kind code	B2
Filing date	Oct 6, 2015
Priority date	Oct 10, 2014
Publication date	Oct 16, 2018
Grant date	Oct 16, 2018

Abstract

The present invention relates to Tau-specific antibodies, fragments thereof, and uses thereof. More specifically, the present invention relates to Tau-specific antibodies, fragments thereof, and conjugates thereof with conjugated to a superparamagnetic nanoparticle. The molecules of the present invention may be used in visualizing damage from traumatic brain injury.

First claim

The invention claimed is:

1. An isolated or purified antibody or fragment thereof, comprising
a complementarity determining region (CDR) 1 sequence of GFTFSNFA (SEQ ID NO:1) or GFTGDHYA (SEQ ID NO:4);
a CDR2 sequence of IDNDGGRT (SEQ ID NO:2) or IYSYSPNT (SEQ ID NO:5);
a CDR3 sequence of AAMNLATRKWEL (SEQ ID NO:3) or AADLEVAEYYAY (SEQ ID NO:6); and
valine at position 42, glycine at position 49, leucine at position 50, and tryptophan at position 52 of the framework (IMGT numbering),
wherein the antibody or fragment thereof specifically binds to Tau.

2. The isolated or purified antibody or fragment thereof of claim 1 , wherein the antibody comprises
a CDR1 sequence of GFTFSNFA (SEQ ID NO:1), a CDR2 sequence of IDNDGGRT (SEQ ID NO:2), and a CDR3 sequence of AAMNLATRKWEL (SEQ ID NO:3); or
a CDR1 sequence of GFTGDHYA (SEQ ID NO:4), a CDR2 sequence of IYSYSPNT (SEQ ID NO:5), and a CDR3 sequence of AADLEVAEYYAY (SEQ ID NO:6).

3. The isolated or purified antibody or fragment thereof of claim 1 , comprising a sequence selected from the group consisting of:

(SEQ ID NO: 7)

QVKLEESGGGLVQPGGSLRLSCAASGFTFSNFAMTWVRQSPGKGLEWVS

AIDNDGGRTSYSDSVKGRFTISRDNAKNTLYLQMNSLKPEDTAMYYCAA

MNLATRKWELWGQGTQVTVSS;

(SEQ ID NO: 8)

QVQLVESGGGLVQPGGSLKLSCAASGFTGDHYAMSWVRQAPGKGLEWVS

TIYSYSPNTYYVDSVKDRFTISLDNAKNTLYLQMNSLKPEDTAVYYCAA

DLEVAEYYAYWGQGTQVTVSS;

and
a sequence at least 90% identical thereto.

4. The isolated or purified antibody or fragment thereof of claim 1 , wherein the antibody is a single-domain antibody (sdAb).

5. The isolated or purified antibody or fragment thereof of claim 4 , wherein the sdAb is of camelid origin.

6. The isolated or purified antibody or fragment thereof of claim 1 , wherein the antibody or fragment thereof is in a multivalent display format.

7. The isolated or purified antibody or fragment thereof of claim 6 , wherein the antibody or fragment thereof is linked to a Fc, C H1 domain, C H2 domain, C H3 domain, a hinge region, or a combination thereof.

8. A nucleic acid molecule encoding the isolated or purified antibody or fragment thereof of claim 1 .

9. A vector comprising the nucleic acid molecule of claim 8 .

10. The isolated or purified antibody or fragment thereof of claim 1 , wherein the antibody or fragment thereof is immobilized onto a surface or is linked to a cargo molecule.

11. The isolated or purified antibody or fragment thereof of claim 10 , wherein the cargo molecule is a detectable agent, or a liposomes or nanocarriers loaded with a detectable agent.

12. The isolated or purified antibody or fragment thereof of claim 11 , wherein the detectable label is a radioisotope, a paramagnetic label, a fluorophore, a Near Infra-Red (NIR) fluorochrome, a dye, an echogenic microbubble, or a superparamagnetic nanoparticle, optionally wherein the nanoparticle has a size of about 10 to about 50 nm.

13. The isolated or purified antibody or fragment thereof of claim 12 , wherein the nanoparticle is a NaDyF4-NaGdF4 core-shell nanoparticle, a silica-coated ferrous oxide, gold nanoparticle, β-NaYF 4 :Yb,Gd,Tm, gadolinium nanoparticle, or a solid lipid nanoparticle.

14. The isolated or purified antibody or fragment thereof of claim 12 , wherein there are about 4 to about 22 antibodies or fragment thereof conjugated to the surface of the nanoparticle.

15. An in vitro method of detecting tau, comprising
a) contacting a tissue sample with one or more than one isolated or purified antibody or fragment thereof of claim 1 linked to a detectable agent; and
b) detecting the detectable agent linked to the antibody or fragment thereof bound to tau in the tissue sample, optionally wherein the step of detecting (step b) is performed using optical imaging, immunohistochemistry, molecular diagnostic imaging, ELISA, or imaging mass spectrometry.

16. The method of claim 15 , wherein the tissue sample is a brain tissue sample from a human or animal subject.

17. An in vivo method of detecting tau expression in a subject, comprising:
a) administering one or more than one isolated or purified antibody or fragment thereof of claim 1 linked to a detectable agent to the subject; and
b) detecting the detectable agent linked to the antibody or fragment thereof bound to tau, optionally wherein the step of detecting (step b) is performed using magnetic resonance imaging (MRI).

18. The method of claim 17 , wherein the detectable agent is a superparamagnetic nanoparticle, optionally wherein the nanoparticle has a size of about 10 to about 50 nm, or optionally wherein the nanoparticle is a NaDyF4-NaGdF4 core-shell nanoparticle.

19. The method of claim 18 , wherein the antibody or fragment thereof is SEQ ID NO:7.

20. The method of claim 18 , wherein there are about 4, 12, or 22 antibodies or fragments thereof conjugated to the surface of the nanoparticle.

Assignees

• Nat Res Council Canada

Inventors

• Sutherland Garnette R
• Lama Sanju
• Arbabi-Ghahroudi Mehdi

Classifications

• C07K17/14

  Peptides being immobilised on, or in, an inorganic carrier · CPC title

• C07K16/18

  against material from animals or humans · CPC title

• A61K51/12

  characterised by a special physical form, e.g. emulsion, microcapsules, liposomes {, characterized by a special physical form, e.g. emulsions, dispersions, microcapsules (liposomes A61K51/1234)} · CPC title

• G01N33/00

  Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00 · CPC title

• A61K49/1875 Primary

  coated or functionalised with an antibody · CPC title