Gram-positive bacteria specific binding compounds

Patent metadata

Field	Value
Publication number	US-9927428-B2
Application number	US-201615246301-A
Country	US
Kind code	B2
Filing date	Aug 24, 2016
Priority date	Jul 15, 2009
Publication date	Mar 27, 2018
Grant date	Mar 27, 2018

Abstract

The present invention provides improved binding compounds capable of specifically binding Gram-positive bacteria. Binding compounds are provided that are fully human, enabling therapeutic applications in human individuals.

First claim

We claim:

1. A method for diagnosing a Staphylococcus infection comprising i) contacting a sample obtained from an individual with an antibody or functional part thereof, wherein the antibody or functional part thereof comprises a heavy chain variable domain and a light chain variable domain comprising:
(a) a heavy chain CDR1 sequence RFAMS (SEQ ID NO:1), and
(b) a heavy chain CDR2 sequence SINNGNNPYYARSVQY (SEQ ID NO:2) or SINSGNNPYYARSVQY (SEQ ID NO:60), and
(c) a heavy chain CDR3 sequence DHPSSGWPTFDS (SEQ ID NO:3), and
(d) a light chain CDR1 sequence RASENVGDWLA (SEQ ID NO:4), and
(e) a light chain CDR2 sequence KTSILES (SEQ ID NO:5), and
(f) a light chain CDR3 sequence QHYXRFPYT (SEQ ID NO:6), wherein X is I or M,

ii) detecting Staphylococcus bacteria bound to the antibody or functional part thereof, thereby diagnosing a Staphylococcus infection in the individual.

2. The method of claim 1 , wherein X in SEQ ID NO:6 is I.

3. The method of claim 1 , wherein X in SEQ ID NO:6 is M.

4. The method of claim 1 , wherein the heavy chain variable domain comprises:
(a) framework 1 (FW1) which has the sequence of

(SEQ ID NO: 38)

EVQLLESGGGLVQPGGSLRLSCAASGFTLS

or

(SEQ ID NO: 61)

EVQLVESGGGLVQPGGSLRLSCAASGFTLS;

(b) framework 2 (FW2) which has the sequence of WVRQAPGRGLEWVA (SEQ ID NO:40);
(c) framework 3 (FW3) which has the sequence of RFTVSRDVSQNTVSLQMNNLRAEDSATYFCAK (SEQ ID NO:42); and
(d) framework 4 (FW4) which has the sequence of WGPGTLVTVSS (SEQ ID NO:44).

5. The method of claim 1 , wherein the light chain variable domain comprises:
(a) framework 1 (FW1) which has the sequence of DIQLTQSPSALPASVGDRVSITC (SEQ ID NO: 48);
(b) framework 2 (FW2) which has the sequence of WYRQKPGKAPNLLIY (SEQ ID NO:50);
(c) framework 3 (FW3) which has the sequence of GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC (SEQ ID NO:52); and
(d) framework 4 (FW4) which has the sequence of FGQGTKLEIKRTV (SEQ ID NO: 54) or FGQGTKVEIKRTV (SEQ ID NO: 59).

6. The method of claim 1 , wherein the heavy chain variable domain comprises:
(a) framework 1 (FW1) which has the sequence of

(SEQ ID NO: 38)

EVQLLESGGGLVQPGGSLRLSCAASGFTLS

or

(SEQ ID NO: 61)

EVQLVESGGGLVQPGGSLRLSCAASGFTLS;

(b) framework 2 (FW2) which has the sequence of WVRQAPGRGLEWVA (SEQ ID NO:40);
(c) framework 3 (FW3) which has the sequence of RFTVSRDVSQNTVSLQMNNLRAEDSATYFCAK (SEQ ID NO:42); and
(d) framework 4 (FW4) which has the sequence of WGPGTLVTVSS (SEQ ID NO:44), and

the light chain variable domain comprises:
(a) framework 1 (FW1) which has the sequence of DIQLTQSPSALPASVGDRVSITC (SEQ ID NO:48);
(b) framework 2 (FW2) which has the sequence of WYRQKPGKAPNLLIY (SEQ ID NO:50);
(c) framework 3 (FW3) which has the sequence of GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC (SEQ ID NO:52); and
(d) framework 4 (FW4) which has the sequence of FGQGTKLEIKRTV (SEQ ID NO: 54) or FGQGTKVEIKRTV (SEQ ID NO: 59).

7. The method of claim 1 , wherein the heavy chain variable domain amino acid sequence comprises:

(SEQ ID NO: 7)

EVQLLESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVAS

INNGNNPYYARSVQYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHP

SSGWPTFDSWGPGTLVTVSS.

8. The method of claim 1 , wherein the heavy chain variable domain amino acid sequence comprises:

(SEQ ID NO: 9)

EVQLVESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVAS

INNGNNPYYARSVQYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHP

SSGWPTFDSWGPGTLVTVSS.

9. The method of claim 1 , wherein the heavy chain variable domain amino acid sequence comprises:

(SEQ ID NO: 62)

EVQLVESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVAS

INSGNNPYYARSVQYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHP

SSGWPTFDSWGPGTLVTVSS.

10. The method of claim 1 , wherein the light chain variable domain amino acid sequence comprises:

(SEQ ID NO: 8)

DIQLTQSPSALPASVGDRVSITCRASENVGDWLAWYRQKPGKAPNLLIYK

TSILESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQHYXRFPYTFGQ

GTKLEIKRTV,

wherein X is I or M.

Assignees

• Genentech Inc
• Aimm Therapeutics Bv

Inventors

• Beaumont Tim
• Kwakkenbos Mark Jeroen
• Brown Eric J
• Morisaki John Hiroshi
• Hazenbos Wouter L W
• Mariathasan Sanjeev
• Kajihara Kimberly
• Xia Yi

Classifications

• A61P31/04

  Antibacterial agents · CPC title

• A61P37/04

  Immunostimulants · CPC title

• A61P31/00

  Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics · CPC title

• A61P37/06

  Immunosuppressants, e.g. drugs for graft rejection · CPC title

• C07K16/1278 Primary

  Bacillus (G) · CPC title