Gram-positive bacteria specific binding compounds
US-9090677-B2 · Jul 28, 2015 · US
US9266943B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-9266943-B2 |
| Application number | US-201314103715-A |
| Country | US |
| Kind code | B2 |
| Filing date | Dec 11, 2013 |
| Priority date | Jul 15, 2009 |
| Publication date | Feb 23, 2016 |
| Grant date | Feb 23, 2016 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
The present invention provides improved binding compounds capable of specifically binding Gram-positive bacteria. Binding compounds are provided that are fully human, enabling therapeutic applications in human individuals.
Opening claim text (preview).
We claim: 1. An isolated antibody or antigen-binding part thereof comprising: (a) a heavy chain CDR1 sequence RFAMS (SEQ ID NO:1), and (b) a heavy chain CDR2 sequence SINSGNNPYYARSVQY (SEQ ID NO:60), and (c) a heavy chain CDR3 sequence DHPSSGWPTFDS (SEQ ID NO:3); and (d) a light chain CDR1 sequence RASENVGDWLA (SEQ ID NO:4), and (e) a light chain CDR2 sequence KTSILES (SEQ ID NO:5), and (f) a light chain CDR3 sequence QHYXRFPYT, wherein X is I or M. 2. The antibody or antigen-binding part thereof of claim 1 wherein the antibody or antigen-binding part thereof has a heavy chain variable domain sequence comprising: (a) framework 1 (FW1) which has the sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTLS (SEQ ID NO: 38); (b) framework 2 (FW2) which has the sequence of WVRQAPGRGLEWVA (SEQ ID NO: 40); (c) framework 3 (FW3) which has the sequence of RFTVSRDVSQNTVSLQMNNLRAEDSATYFCAK (SEQ ID NO: 42); and (d) framework 4 (FW4) which has the sequence of WGPGTLVTVSS (SEQ ID NO: 44). 3. The antibody or antigen-binding part thereof of claim 1 wherein the antibody or antigen-binding part thereof has a light chain variable domain sequence comprising: (a) framework 1 (FW1) which has the sequence of DIQLTQSPSALPASVGDRVSITC (SEQ ID NO: 48); (b) framework 2 (FW2) which has the sequence of WYRQKPGKAPNLLIY (SEQ ID NO: 50); (c) framework 3 (FW3) which has the sequence of GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC (SEQ ID NO: 52); and (d) framework 4 (FW4) which has the sequence of FGQGTKLEIKRTV (SEQ ID NO: 54) or FGQGTKVEIKRTV (SEQ ID NO: 59). 4. The antibody or antigen-binding part thereof of claim 1 wherein the antibody or antigen-binding part thereof has a heavy chain variable domain sequence comprising: (a) framework 1 (FW1) which has the sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTLS (SEQ ID NO: 38); (b) framework 2 (FW2) which has the sequence of WVRQAPGRGLEWVA (SEQ ID NO: 40); (c) framework 3 (FW3) which has the sequence of RFTVSRDVSQNTVSLQMNNLRAEDSATYFCAK (SEQ ID NO: 42); and (d) framework 4 (FW4) which has the sequence of WGPGTLVTVSS (SEQ ID NO: 44) and wherein the antibody or antigen-binding part thereof has a light chain variable domain sequence comprising: (a) framework 1 (FW1) which has the sequence of DIQLTQSPSALPASVGDRVSITC (SEQ ID NO: 48); (b) framework 2 (FW2) which has the sequence of WYRQKPGKAPNLLIY (SEQ ID NO: 50); (c) framework 3 (FW3) which has the sequence of GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC (SEQ ID NO: 52); and (d) framework 4 (FW4) which has the sequence of framework 4 (FW4) which has the sequence of FGQGTKLEIKRTV (SEQ ID NO: 54) or FGQGTKVEIKRTV (SEQ ID NO: 59). 5. The antibody or antigen-binding part thereof of claim 1 wherein the antibody or antigen-binding part thereof comprises a light chain variable domain comprising a sequence of DIQLTQSPSALPASVGDRVSITCRASENVGDWLAWYRQKPGKAPNLLIYKTSILESGVPSRF SGSGSGTEFTLTISSLQPDDFATYYCQHYXRFPYTFGQGTKVEIKRTV, wherein X is I (SEQ ID NO:11). 6. The antibody or antigen-binding part thereof of claim 1 wherein the antibody or antigen-binding part thereof has a heavy chain variable domain sequence comprising: (a) framework 1 (FW1) which has the sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTLS (SEQ ID NO: 61); (b) framework 2 (FW2) which has the sequence of WVRQAPGRGLEWVA (SEQ ID NO: 40); (c) framework 3 (FW3) which has the sequence of RFTVSRDVSQNTVSLQMNNLRAEDSATYFCAK (SEQ ID NO: 42); and (d) framework 4 (FW4) which has the sequence of WGPGTLVTVSS (SEQ ID NO: 44). 7. The antibody or antigen-binding part thereof of claim 1 wherein the antibody or antigen-binding part thereof has a heavy chain variable domain sequence comprising: (a) framework 1 (FW1) which has the sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTLS (SEQ ID NO: 61); (b) framework 2 (FW2) which has the sequence of WVRQAPGRGLEWVA (SEQ ID NO: 40); (c) framework 3 (FW3) which has the sequence of RFTVSRDVSQNTVSLQMNNLRAEDSATYFCAK (SEQ ID NO: 42); and (d) framework 4 (FW4) which has the sequence of WGPGTLVTVSS (SEQ ID NO: 44) and wherein the antibody or antigen-binding part thereof has a light chain variable domain sequence comprising: (a) framework 1 (FW1) which has the sequence of DIQLTQSPSALPASVGDRVSITC (SEQ ID NO: 48); (b) framework 2 (FW2) which has the sequence of WYRQKPGKAPNLLIY (SEQ ID NO: 50); (c) framework 3 (FW3) which has the sequence of GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC (SEQ ID NO: 52); and (d) framework 4 (FW4) which has the sequence of framework 4 (FW4) which has the sequence of FGQGTKLEIKRTV (SEQ ID NO: 54) or FGQGTKVEIKRTV (SEQ ID NO: 59). 8. The antibody or antigen-binding part thereof of claim 1 wherein antibody or antigen-binding part thereof comprises: (a) a heavy chain variable domain comprising a sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVASINSG NNPYYARSVQYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHPSSGWPTFD SWGPGTLVTVSS (SEQ ID NO:62) and (b) a light chain variable domain comprising a sequence of DIQLTQSPSALPASVGDRVSITCRASENVGDWLAWYRQKPGKAPNLLIYKTSILES GVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQHYXRFPYTFGQGTKVEIKRTV, wherein X is I (SEQ ID NO:11). 9. The antibody or antigen-binding part thereof of claim 8 , further comprising a heavy chain constant domain comprising the sequence of: ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCP (SEQ ID NO:63). 10. The antibody or antigen-binding part thereof of claim 8 , further comprising a light chain constant domain comprising the sequence of: AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO:64). 11. The antibody or antigen-binding part thereof of claim 8 , further comprising (a) a heavy chain constant domain comprising the sequence of: ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCP (SEQ ID NO:63) and; (b) a light chain constant domain comprising the sequence of: AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO:64). 12. The antibody or antigen-binding part thereof of claim 8 , further comprising (a) a heavy chain constant domain comprising the sequence of: ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCP (SEQ ID NO:63); and (b) a light chain constant domain comprising the sequence of: AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPCTKSFNRGEC (SEQ ID NO:65). 13. The antibody or antigen-binding part thereof of claim 8 , further comprising (a) a heavy chain constant domain comprising the sequence of: CSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP (SEQ ID NO:66) and; (b) a light chain constant domain comprising the sequence of: AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPCTKSFNRGEC (SEQ ID NO:65). 14. The antibody or antigen-binding part thereof of claim 8 , further comprising (a) a heavy chain constant domain comprising the sequence of: CSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP (SEQ ID NO:66) and; (b) a light chain constant domain comprising the sequence of: AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO:64). 15. The antibody or antigen-binding part thereof of claim 1 wherein the antibody or antigen-binding part thereof is coupled to a cytotoxic agent. 16. The antibody or antigen-binding part
Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics · CPC title
Antibacterial agents · CPC title
Immunosuppressants, e.g. drugs for graft rejection · CPC title
Immunostimulants · CPC title
Constant or Fc region; Isotype · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.