RNA-interference by single-stranded RNA molecules
US-10023865-B2 · Jul 17, 2018 · US
US11504432B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-11504432-B2 |
| Application number | US-201716345716-A |
| Country | US |
| Kind code | B2 |
| Filing date | Oct 27, 2017 |
| Priority date | Oct 28, 2016 |
| Publication date | Nov 22, 2022 |
| Grant date | Nov 22, 2022 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
The present invention provides the modular design and assembly of novel targeting bio-conjugates, exclusively assembled by means of biotin-biotin binding element conjugation, comprising mono-biotinylated cell binding component, a tetrameric biotin-binding element, and mono-biotinylated payload for therapeutic and diagnostic purposes. In addition, there is provided a method of delivering the payload, such as therapeutic oligonucleotides, via mono-biotinylated targeting devices, such as antibodies or ligands, into eukaryotic cells by means of receptor-mediated endocytosis. The targeting bio-conjugates are suitable for use in the areas of medicine, pharmacy and biomedical research.
Opening claim text (preview).
The invention claimed is: 1. A delivery system for targeted delivery of a therapeutically active payload, comprising: an avidin core, wherein the avidin core consists of avidin, neutravidin or streptavidin; at least one targeting molecule selected from the group consisting of antibody single-chain variable fragments (scFv), wherein the antibody single-chain variable fragment is selected from scFv(AM1) (SEQ ID NO: 1), scFv(h-AM-1) (SEQ ID NO: 2) and scFv(MR1.1) (SEQ ID NO: 3, and SEQ ID NO: 4); and at least one the therapeutically active payload selected from the group consisting of proteins, peptides and therapeutically active nucleic acids, wherein said at least one targeting molecule and said at least one therapeutically active payload are bound to the avidin core; and said antibody single-chain variable fragment is comprised in a construct, having the structure: antibody single-chain variable fragment-biotinylation acceptor peptide (BAP); or antibody single-chain variable fragment-linker-BAP; and said antibody single-chain variable fragment construct is mono-biotinylated at the BAP. 2. The delivery system according to claim 1 , comprising a. one antibody single-chain variable fragment and three therapeutically active nucleic acids, or b. two antibody single-chain variable fragments and two therapeutically active nucleic acids, or c. three antibody single-chain variable fragments and one therapeutically active nucleic acid. 3. The delivery system according to claim 1 , wherein the antibody single-chain variable fragment is scFv(AM1) (SEQ ID NO: 1). 4. The delivery system according to claim 1 , wherein said BAP is selected from the group consisting of: MKLKVTVNGTAYDVDVDVDKSHENPMGTILFGGGTGGAPAPAAGGA GAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEIN APTDGKVEKVLVKERDAVQGGQGLIKIGDLEL (SEQ ID NO. 5); VLRSPMPGVVVAVSVKPGDAVAEGQEICVIEAMKMQNSMTAGKTGT VKSVHCQAGDTVGEGDLLVELE (SEQ ID NO: 6); LX1X2IFEAQKIEWR (SEQ ID NO: 7), wherein X 1 =any amino acid; and X 2 =is any amino acid except L, V, I, W, F or Y; GLNDIFEAQKIEWHE (SEQ ID NO. 8); ALNDIFEAQKIEWHA (SEQ ID NO: 9); MAGGLNDIFEAQKIEWHEDTGGS (SEQ ID NO. 10); MSGLNDIFEAQKIEWHEGAPSSR (SEQ ID NO: 11); and LHHILDAQKMVWNHR (SEQ ID NO: 12). 5. The delivery system according to claim 1 , wherein said linker peptide is selected from the group a) two amino acids; b) 6 amino acids; c) 10 amino acids; and d) the c-myc tag having the amino acid sequence of EQKLISEEDL (SEQ ID NO: 13). 6. The delivery system according to claim 1 , wherein said therapeutically active payload is a therapeutically active nucleic acid selected from the group consisting of CpG oligonucleotides, ssDNA, dsDNA, ssRNA or dsRNA. 7. The delivery system according to claim 1 , wherein said therapeutically active payload is biotinylated. 8. The delivery system according to claim 1 , wherein said therapeutically active nucleic acid is a siRNA, wherein said siRNA is comprised in a carrier, which comprises a glycodendrimer. 9. The delivery system according to claim 8 , wherein said glycodendrimer is a transfection disabled nucleotide carrier, wherein said glycodendrimer comprising a maltose-poly-propylene-imine (mal-PPI) dendrimer comprising one biotin molecule when complexed with siRNA, suitably based on mal19-PPI. 10. The delivery system according to claim 1 , wherein said delivery system binds, through the at least one antibody single chain fragment, to a surface antigen, which is specifically expressed at or in cell membranes of cancer cells. 11. A pharmaceutical composition comprising the delivery system according to claim 1 and a pharmaceutically acceptable carrier or diluent. 12. The pharmaceutical composition according to claim 11 , wherein said pharmaceutical composition further comprises an EGF receptor inhibitor selected from tyrosine kinase inhibitors or monoclonal antibodies; gefitinib, erlotinib, afatinib and osimertinib and cetuximab; and CimaVax-EGF.
pre-targeting systems involving an organic compound, other than a peptide, protein or antibody, for targeting specific cells · CPC title
the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment · CPC title
Drugs for disorders of the nervous system · CPC title
Antineoplastic agents · CPC title
Antihyperlipidemics · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.