FcRn antibodies and methods of use thereof

US11345751B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-11345751-B2
Application numberUS-201716321801-A
CountryUS
Kind codeB2
Filing dateJul 31, 2017
Priority dateJul 29, 2016
Publication dateMay 31, 2022
Grant dateMay 31, 2022

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The present application features antibodies that bind to human neonatal Fc receptor (FcRn). These anti-FcRn antibodies are useful, e.g., to promote clearance of autoantibodies in a subject, to suppress antigen presentation in a subject, to block an immune response, e.g., block an immune complex-based activation of the immune response in a subject, and to treat immunological diseases (e.g., autoimmune diseases) in a subject. These anti-FcRn antibodies are also useful, e.g., to decrease pathogenic antibody transport across the placenta of a pregnant subject, to increase pathogenic antibody catabolism in a pregnant subject, and to treat an antibody-mediated enhancement of viral disease in a fetus or a neonate.

First claim

Opening claim text (preview).

What is claimed is: 1. A method of treating an alloimmune and/or autoimmune disorder comprising administering an antibody to a pregnant subject, wherein the antibody comprises: (1) a light chain variable region comprising a CDR L1, a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1, a CDR H2, and a CDR H3, wherein the CDR L1 comprises a sequence X 1 GTGSDVGSYNX 2 VS (SEQ ID NO: 12), the CDR L2 comprises a sequence GDX 3 X 4 RPS (SEQ ID NO: 13), the CDR L3 comprises a sequence X 5 SYX 6 GSGIYV (SEQ ID NO: 14), the CDR H1 comprises a sequence Z 1 YAMG (SEQ ID NO: 15), the CDR H2 comprises a sequence Z 7 IGZ 2 SGZ 3 QTZ 4 YADS (SEQ ID NO: 16), and the CDR H3 comprises a sequence LAZ 5 Z 6 DSY (SEQ ID NO: 17), wherein X 1 is a polar or hydrophobic amino acid, X 2 is a hydrophobic amino acid, X 3 is a polar amino acid, X 4 is a polar or acidic amino acid, X 5 is a polar or hydrophobic amino acid, X 6 is a hydrophobic amino acid, Z 1 is a polar or acidic amino acid, Z 2 is a polar or hydrophobic amino acid, Z 3 is G, S, or A, Z 4 is a basic amino acid, Z 5 is a hydrophobic or basic amino acid, Z 6 is G, S, D, Q, or H, and Z 7 is S or T. 2. The method of claim 1 , wherein the antibody comprises: (1) a light chain variable region comprising a CDR L1, a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1, a CDR H2, and a CDR H3, wherein the CDR L1 comprises the sequence X 1 GTGSDVGSYNLVS (SEQ ID NO: 48) or TGTGSDVGSYNX 2 VS (SEQ ID NO: 49), the CDR L2 comprises the sequence GDX 3 ERPS (SEQ ID NO: 50) or GDSX 4 RPS (SEQ ID NO: 51), the CDR L3 comprises the sequence X 5 SYAGSGIYV (SEQ ID NO: 52) or SSYX 6 GSGIYV (SEQ ID NO: 53), the CDR H1 comprises the sequence of TYAMG (SEQ ID NO: 4), DYAMG (SEQ ID NO: 5), or NYAMG (SEQ ID NO: 6), the CDR H2 comprises the sequence of SIGASGSQTRYADS (SEQ ID NO: 8), SIGSSGAQTRYADS (SEQ ID NO: 7), SIGASGAQTRYADS (SEQ ID NO: 9), SIGASGGQTRYADS (SEQ ID NO: 10), TIGSSGAQTRYADS (SEQ ID NO: 41), SIGASGSQTRYADS (SEQ ID NO: 42), TIGASGAQTRYADS (SEQ ID NO: 43), or TIGASGGQTRYADS (SEQ ID NO: 46), and the CDR H3 comprises the sequence LAZ 5 GDSY (SEQ ID NO: 54) or LAIZ 6 DSY (SEQ ID NO: 55). 3. The method of claim 2 , wherein the antibody comprises (1) a light chain variable region comprising a CDR L1, a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1, a CDR H2, and a CDR H3, wherein the CDR L1 comprises the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), the CDR L2 comprises the sequence GDSERPS (SEQ ID NO: 2), the CDR L3 comprises the sequence SSYAGSGIYV (SEQ ID NO: 3), the CDR H1 comprises the sequence TYAMG (SEQ ID NO: 4), the CDR H2 comprises the sequence SIGSSGAQTRYADS (SEQ ID NO: 7), or TIGSSGAQTRYADS (SEQ ID NO: 41), and the CDR H3 comprises the sequence LAIGDSY (SEQ ID NO: 11). 4. The method of claim 2 , wherein the CDR L1 of the isolated antibody comprises the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), the CDR L2 of the isolated antibody comprises the sequence GDSERPS (SEQ ID NO: 2), the CDR L3 of the isolated antibody comprises the sequence SSYAGSGIYV (SEQ ID NO: 3), the CDR H1 of the isolated antibody comprises the sequence NYAMG (SEQ ID NO: 6), the CDR H2 of the isolated antibody comprises the sequence SIGASGAQTRYADS (SEQ ID NO: 9) or TIGASGAQTRYADS (SEQ ID NO: 43), and the CDR H3 of the isolated antibody comprises the sequence LAIGDSY (SEQ ID NO: 11). 5. The method of claim 1 , wherein the light chain comprises an amino acid sequence having at least 90% identity to the sequence: (SEQ ID NO: 19) QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGK APKLMIYGDSERPSGVSNRFSGSKSGNTASLTISGLQAEDEADY YCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQAN KATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKY AASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS. 6. The method of claim 5 , wherein the light chain variable region of the isolated antibody comprises a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of SEQ ID NO: 19. 7. The method of claim 1 , wherein the heavy chain comprises an amino acid sequence selected from the group consisting of: a sequence having at least 90% identity to the sequence of (SEQ ID NO: 20) EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMGWVRQAPGKG LEWVSSIGSSGAQTRYADSVKGRFTISRDNSKNTLYLQMNSLRA EDTAVYYCARLAIGDSYWGQGTMVTVSSASTKGPSVFPLAPSSK STSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHTCPPCPAPELIGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPG; a sequence having at least 90% identity to the sequence of (SEQ ID NO: 21) EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMGWVRQAPGKG LEWVSSIGASGSQTRYADSVKGRFTISRDNSKNTLYLQMNSLRA EDTAVYYCARLAIGDSYWGQGTMVTVSSASTKGPSVFPLAPSSK

Assignees

Inventors

Classifications

  • C07K16/283Primary

    against Fc-receptors, e.g. CD16, CD32, CD64 (CD23 C07K16/2851) · CPC title

  • Antianaemics · CPC title

  • Immunosuppressants, e.g. drugs for graft rejection · CPC title

  • comprising antibodies · CPC title

  • Complementarity determining region [CDR] · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US11345751B2 cover?
The present application features antibodies that bind to human neonatal Fc receptor (FcRn). These anti-FcRn antibodies are useful, e.g., to promote clearance of autoantibodies in a subject, to suppress antigen presentation in a subject, to block an immune response, e.g., block an immune complex-based activation of the immune response in a subject, and to treat immunological diseases (e.g., auto…
Who is the assignee on this patent?
Momenta Pharmaceuticals Inc
What technology area does this patent fall under?
Primary CPC classification C07K16/283. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue May 31 2022 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 5 related publications on this page (citations in our corpus or others sharing the same primary CPC).