FcRn Antibodies and Methods of Use Thereof
US-2020299382-A1 · Sep 24, 2020 · US
US11345751B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-11345751-B2 |
| Application number | US-201716321801-A |
| Country | US |
| Kind code | B2 |
| Filing date | Jul 31, 2017 |
| Priority date | Jul 29, 2016 |
| Publication date | May 31, 2022 |
| Grant date | May 31, 2022 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
The present application features antibodies that bind to human neonatal Fc receptor (FcRn). These anti-FcRn antibodies are useful, e.g., to promote clearance of autoantibodies in a subject, to suppress antigen presentation in a subject, to block an immune response, e.g., block an immune complex-based activation of the immune response in a subject, and to treat immunological diseases (e.g., autoimmune diseases) in a subject. These anti-FcRn antibodies are also useful, e.g., to decrease pathogenic antibody transport across the placenta of a pregnant subject, to increase pathogenic antibody catabolism in a pregnant subject, and to treat an antibody-mediated enhancement of viral disease in a fetus or a neonate.
Opening claim text (preview).
What is claimed is: 1. A method of treating an alloimmune and/or autoimmune disorder comprising administering an antibody to a pregnant subject, wherein the antibody comprises: (1) a light chain variable region comprising a CDR L1, a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1, a CDR H2, and a CDR H3, wherein the CDR L1 comprises a sequence X 1 GTGSDVGSYNX 2 VS (SEQ ID NO: 12), the CDR L2 comprises a sequence GDX 3 X 4 RPS (SEQ ID NO: 13), the CDR L3 comprises a sequence X 5 SYX 6 GSGIYV (SEQ ID NO: 14), the CDR H1 comprises a sequence Z 1 YAMG (SEQ ID NO: 15), the CDR H2 comprises a sequence Z 7 IGZ 2 SGZ 3 QTZ 4 YADS (SEQ ID NO: 16), and the CDR H3 comprises a sequence LAZ 5 Z 6 DSY (SEQ ID NO: 17), wherein X 1 is a polar or hydrophobic amino acid, X 2 is a hydrophobic amino acid, X 3 is a polar amino acid, X 4 is a polar or acidic amino acid, X 5 is a polar or hydrophobic amino acid, X 6 is a hydrophobic amino acid, Z 1 is a polar or acidic amino acid, Z 2 is a polar or hydrophobic amino acid, Z 3 is G, S, or A, Z 4 is a basic amino acid, Z 5 is a hydrophobic or basic amino acid, Z 6 is G, S, D, Q, or H, and Z 7 is S or T. 2. The method of claim 1 , wherein the antibody comprises: (1) a light chain variable region comprising a CDR L1, a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1, a CDR H2, and a CDR H3, wherein the CDR L1 comprises the sequence X 1 GTGSDVGSYNLVS (SEQ ID NO: 48) or TGTGSDVGSYNX 2 VS (SEQ ID NO: 49), the CDR L2 comprises the sequence GDX 3 ERPS (SEQ ID NO: 50) or GDSX 4 RPS (SEQ ID NO: 51), the CDR L3 comprises the sequence X 5 SYAGSGIYV (SEQ ID NO: 52) or SSYX 6 GSGIYV (SEQ ID NO: 53), the CDR H1 comprises the sequence of TYAMG (SEQ ID NO: 4), DYAMG (SEQ ID NO: 5), or NYAMG (SEQ ID NO: 6), the CDR H2 comprises the sequence of SIGASGSQTRYADS (SEQ ID NO: 8), SIGSSGAQTRYADS (SEQ ID NO: 7), SIGASGAQTRYADS (SEQ ID NO: 9), SIGASGGQTRYADS (SEQ ID NO: 10), TIGSSGAQTRYADS (SEQ ID NO: 41), SIGASGSQTRYADS (SEQ ID NO: 42), TIGASGAQTRYADS (SEQ ID NO: 43), or TIGASGGQTRYADS (SEQ ID NO: 46), and the CDR H3 comprises the sequence LAZ 5 GDSY (SEQ ID NO: 54) or LAIZ 6 DSY (SEQ ID NO: 55). 3. The method of claim 2 , wherein the antibody comprises (1) a light chain variable region comprising a CDR L1, a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1, a CDR H2, and a CDR H3, wherein the CDR L1 comprises the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), the CDR L2 comprises the sequence GDSERPS (SEQ ID NO: 2), the CDR L3 comprises the sequence SSYAGSGIYV (SEQ ID NO: 3), the CDR H1 comprises the sequence TYAMG (SEQ ID NO: 4), the CDR H2 comprises the sequence SIGSSGAQTRYADS (SEQ ID NO: 7), or TIGSSGAQTRYADS (SEQ ID NO: 41), and the CDR H3 comprises the sequence LAIGDSY (SEQ ID NO: 11). 4. The method of claim 2 , wherein the CDR L1 of the isolated antibody comprises the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), the CDR L2 of the isolated antibody comprises the sequence GDSERPS (SEQ ID NO: 2), the CDR L3 of the isolated antibody comprises the sequence SSYAGSGIYV (SEQ ID NO: 3), the CDR H1 of the isolated antibody comprises the sequence NYAMG (SEQ ID NO: 6), the CDR H2 of the isolated antibody comprises the sequence SIGASGAQTRYADS (SEQ ID NO: 9) or TIGASGAQTRYADS (SEQ ID NO: 43), and the CDR H3 of the isolated antibody comprises the sequence LAIGDSY (SEQ ID NO: 11). 5. The method of claim 1 , wherein the light chain comprises an amino acid sequence having at least 90% identity to the sequence: (SEQ ID NO: 19) QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGK APKLMIYGDSERPSGVSNRFSGSKSGNTASLTISGLQAEDEADY YCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQAN KATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKY AASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS. 6. The method of claim 5 , wherein the light chain variable region of the isolated antibody comprises a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of SEQ ID NO: 19. 7. The method of claim 1 , wherein the heavy chain comprises an amino acid sequence selected from the group consisting of: a sequence having at least 90% identity to the sequence of (SEQ ID NO: 20) EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMGWVRQAPGKG LEWVSSIGSSGAQTRYADSVKGRFTISRDNSKNTLYLQMNSLRA EDTAVYYCARLAIGDSYWGQGTMVTVSSASTKGPSVFPLAPSSK STSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHTCPPCPAPELIGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPG; a sequence having at least 90% identity to the sequence of (SEQ ID NO: 21) EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMGWVRQAPGKG LEWVSSIGASGSQTRYADSVKGRFTISRDNSKNTLYLQMNSLRA EDTAVYYCARLAIGDSYWGQGTMVTVSSASTKGPSVFPLAPSSK
against Fc-receptors, e.g. CD16, CD32, CD64 (CD23 C07K16/2851) · CPC title
Antianaemics · CPC title
Immunosuppressants, e.g. drugs for graft rejection · CPC title
comprising antibodies · CPC title
Complementarity determining region [CDR] · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.