FcRn antibodies and methods of use thereof

US10676526B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-10676526-B2
Application numberUS-201615546870-A
CountryUS
Kind codeB2
Filing dateJan 29, 2016
Priority dateJan 30, 2015
Publication dateJun 9, 2020
Grant dateJun 9, 2020

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The present invention features antibodies that have high binding affinity to human neonatal Fc receptor (FcRn). These anti-FcRn antibodies are useful, e.g., to promote clearance of autoantibodies in a subject, to suppress antigen presentation in a subject, to block an immune response, e.g., block an immune complex-based activation of the immune response in a subject, and to treat immunological diseases (e.g., autoimmune diseases) in a subject.

First claim

Opening claim text (preview).

What is claimed is: 1. An isolated antibody that binds to human FcRn, the isolated antibody comprising: (1) a light chain variable region comprising a CDR L1, a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1, a CDR H2, and a CDR H3, wherein the isolated antibody is selected from the group consisting of: (a) an antibody wherein CDR L1 comprises the amino acid sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), CDR L2 comprises the amino acid sequence GDSERPS (SEQ ID NO: 2), CDR L3 comprises the amino acid sequence SSYAGSGIYV (SEQ ID NO: 3), CDR H1 comprises the amino acid sequence TYAMG (SEQ ID NO: 4), CDR H2 comprise the amino acid sequence SIGSSGAQTRYADS (SEQ ID NO: 7), and CDR H3 comprises the amino acid sequence LAIGDSY (SEQ ID NO: 11); (b) an antibody wherein CDR L1 comprises the amino acid sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), CDR L2 comprises the amino acid sequence GDSERPS (SEQ ID NO: 2), CDR L3 comprises the amino acid sequence SSYAGSGIYV (SEQ ID NO: 3), CDR H1 comprises the amino acid sequence DYAMG (SEQ ID NO: 5), CDR H2 comprise the amino acid sequence SIGASGSQTRYADS (SEQ ID NO: 8), and CDR H3 comprises the amino acid sequence LAIGDSY (SEQ ID NO: 11); (c) an antibody wherein CDR L1 comprises the amino acid sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), CDR L2 comprises the amino acid sequence GDSERPS (SEQ ID NO: 2), CDR L3 comprises the amino acid sequence SSYAGSGIYV (SEQ ID NO: 3), CDR H1 comprises the amino acid sequence NYAMG (SEQ ID NO: 6), CDR H2 comprise the amino acid sequence SIGASGAQTRYADS (SEQ ID NO: 9), and CDR H3 comprises the amino acid sequence LAIGDSY (SEQ ID NO: 11); (d) an antibody wherein CDR L1 comprises the amino acid sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), CDR L2 comprises the amino acid sequence GDSERPS (SEQ ID NO: 2), CDR L3 comprises the amino acid sequence SSYAGSGIYV (SEQ ID NO: 3), CDR H1 comprises the amino acid sequence TYAMG (SEQ ID NO: 4), CDR H2 comprise the amino acid sequence SIGASGGQTRYADS (SEQ ID NO: 10), and CDR H3 comprises the amino acid sequence LAIGDSY (SEQ ID NO: 11); and (e) an antibody wherein CDR L1 comprises the amino acid sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), CDR L2 comprises the amino acid sequence GDSERPS (SEQ ID NO: 2), CDR L3 comprises the amino acid sequence SSYAGSGIYV (SEQ ID NO: 3), CDR H1 comprises the amino acid sequence TYAMG (SEQ ID NO: 4), CDR H2 comprise the amino acid sequence SIGASGSQTRYADS (SEQ ID NO: 8) and CDR H3 comprises the amino acid sequence LAIGDSY (SEQ ID NO: 11). 2. The isolated antibody of claim 1 , wherein the antibody binds human FcRn with a K D of less than or equal to that of an antibody having a light chain comprising the amino acid sequence of SEQ ID NO: 19 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 23. 3. The isolated antibody of claim 1 , wherein CDR L1 comprises the amino acid sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), CDR L2 comprises the amino acid sequence GDSERPS (SEQ ID NO: 2), CDR L3 comprises the amino acid sequence SSYAGSGIYV (SEQ ID NO: 3), CDR H1 comprises the amino acid sequence TYAMG (SEQ ID NO: 4), CDR H2 comprises the amino acid sequence SIGASGSQTRYADS (SEQ ID NO: 8), and CDR H3 comprises the amino acid sequence LAIGDSY (SEQ ID NO: 11). 4. The isolated antibody of claim 1 , wherein CDR L1 comprises the amino acid sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), CDR L2 comprises the amino acid sequence GDSERPS (SEQ ID NO: 2), CDR L3 comprises the amino acid sequence SSYAGSGIYV (SEQ ID NO: 3), CDR H1 comprises the amino acid sequence TYAMG (SEQ ID NO: 4), CDR H2 comprise the amino acid sequence SIGSSGAQTRYADS (SEQ ID NO: 7), and CDR H3 comprises the amino acid sequence LAIGDSY (SEQ ID NO: 11); and the light chain of comprises an amino acid sequence having at least 90% identity to (SEQ ID NO: 19) QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMI YGDSERPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSGIYV FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVT HEGSTVEKTVAPTECS. 5. The isolated antibody of claim 1 or claim 4 , wherein CDR L1 comprises the amino acid sequence TGTGSDVGSYNLVS (SEQ ID NO: 1), CDR L2 comprises the amino acid sequence GDSERPS (SEQ ID NO: 2), CDR L3 comprises the amino acid sequences SSYAGSGIYV (SEQ ID NO: 3), CDR H1 comprises the amino acid sequence TYAMG (SEQ ID NO: 4), CDR H2 comprise the amino acid sequence SIGASGSQTRYADS (SEQ ID NO: 8), and CDR H3 comprises the amino acid sequence LAIGDSY (SEQ ID NO: 11); and the heavy chain comprises an amino acid sequence having at least 90% identity to (SEQ ID NO: 24) EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMGWVRQAPGKGLEWVSS IGASGSQTRYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLA IGDSYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG. 6. An isolated antibody that binds to human FcRn selected from the group consisting of: (a) an antibody comprising a light chain comprising the amino acid sequence (SEQ ID NO: 19) QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMI YGDSERPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSGIYV FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVT

Assignees

Inventors

Classifications

  • Complementarity determining region [CDR] · CPC title

  • Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity · CPC title

  • Antagonist effect on antigen, e.g. neutralization or inhibition of binding · CPC title

  • C07K16/283Primary

    against Fc-receptors, e.g. CD16, CD32, CD64 (CD23 C07K16/2851) · CPC title

  • comprising antibodies · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US10676526B2 cover?
The present invention features antibodies that have high binding affinity to human neonatal Fc receptor (FcRn). These anti-FcRn antibodies are useful, e.g., to promote clearance of autoantibodies in a subject, to suppress antigen presentation in a subject, to block an immune response, e.g., block an immune complex-based activation of the immune response in a subject, and to treat immunological …
Who is the assignee on this patent?
Momenta Pharmaceuticals Inc
What technology area does this patent fall under?
Primary CPC classification C07K16/283. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Jun 09 2020 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).