Compositions comprising fusion variants of FGF19 polypeptides

Patent metadata

Field	Value
Publication number	US-11065302-B2
Application number	US-201816017759-A
Country	US
Kind code	B2
Filing date	Jun 25, 2018
Priority date	Jul 1, 2011
Publication date	Jul 20, 2021
Grant date	Jul 20, 2021

Abstract

The invention relates to variants and fusions of fibroblast growth factor 19 (FGF19), variants and fusions of fibroblast growth factor 21 (FGF21), fusions of fibroblast growth factor 19 (FGF19) and/or fibroblast growth factor 21 (FGF21), and variants or fusions of fibroblast growth factor 19 (FGF19) and/or fibroblast growth factor 21 (FGF21) proteins and peptide sequences (and peptidomimetics), having one or more activities, such as glucose lowering activity, and methods for and uses in treatment of hyperglycemia and other disorders.

First claim

What is claimed is:

1. A peptide having an amino acid sequence comprising

(SEQ ID NO: 52)

RDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSL

LEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPD

GYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDL

RGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK.

2. The peptide of claim 1 , wherein the peptide is fused to an immunoglobulin Fc region.

3. A pharmaceutical composition, comprising the peptide of claim 2 , and a pharmaceutically acceptable carrier.

4. A pharmaceutical composition, comprising the peptide of claim 2 , a glucose lowering agent, and a pharmaceutically acceptable carrier.

5. A pharmaceutical composition, comprising the peptide of claim 1 , and a pharmaceutically acceptable carrier.

6. A pharmaceutical composition, comprising the peptide of claim 1 , a glucose lowering agent, and a pharmaceutically acceptable carrier.

7. A peptide having an amino acid sequence consisting of

(SEQ ID NO: 52)

RDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSL

LEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPD

GYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDL

RGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK.

8. The peptide of claim 7 , wherein the peptide is fused to an immunoglobulin Fc region.

9. A pharmaceutical composition, comprising the peptide of claim 8 , and a pharmaceutically acceptable carrier.

10. A pharmaceutical composition, comprising the peptide of claim 8 , a glucose lowering agent, and a pharmaceutically acceptable carrier.

11. A pharmaceutical composition, comprising the peptide of claim 7 , and a pharmaceutically acceptable carrier.

12. A pharmaceutical composition, comprising the peptide of claim 7 , a glucose lowering agent, and a pharmaceutically acceptable carrier.

Assignees

• Ngm Biopharmaceuticals Inc

Inventors

• Ling Lei
• Lindhout Darrin Anthony

Classifications

• A61K45/06

  Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca · CPC title

• A61K31/155

  Amidines ([IMAGE cpc-sch-A61K-1029.gif]), e.g. guanidine (H2N—C(=NH)—NH2), isourea (N=C(OH)—NH2), isothiourea (—N=C(SH)—NH2) · CPC title

• A61K38/00

  Medicinal preparations containing peptides (peptides containing beta-lactam rings A61K31/00; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, A61K31/00; ergot alkaloids of the cyclic peptide type A61K31/48; containing macromolecular compounds having statistically distributed amino acid units A61K31/74; medicinal preparations containing antigens or antibodies A61K39/00; medicinal preparations characterised by the non-active ingredients, e.g. peptides as drug carriers, A61K47/00) · CPC title

• A61K31/785

  Polymers containing nitrogen · CPC title

• A61P3/06

  Antihyperlipidemics · CPC title