Treatment for rheumatoid arthritis

Patent metadata

Field	Value
Publication number	US-10913792-B2
Application number	US-201815880726-A
Country	US
Kind code	B2
Filing date	Jan 26, 2018
Priority date	Sep 20, 2012
Publication date	Feb 9, 2021
Grant date	Feb 9, 2021

Abstract

The present invention provides anti-GM-CSF antibodies for use in the treatment of rheumatoid arthritis. Anti-GM-CSF antibodies, in particular MOR103, are administered to patients suffering from rheumatoid arthritis at dosages that are beneficial in a clinical setting.

First claim

The invention claimed is:

1. A method of treating a patient suffering from rheumatoid arthritis, said method comprising administering to said patient a once a week anti-Granulocvte-Macrophage Colony Stimulating Factor (anti-GM-CSF) pharmaceutical composition comprising:
(a) 1-4 mg/Kg of anti-GM-CSF antibody;
(b) 30 mM histidine;
(c) 200 mM sorbitol; and
(d) 0.02% Tween-80,
wherein said anti-GM-CSF antibody comprises the HCDR1 region of sequence GFTFSSYWMN (SEQ ID NO.: 2), the HCDR2 region of sequence GIENKYAGGATYYAASVKG (SEQ ID NO.: 3), the HCDR3 region of sequence GFGTDF (SEQ ID NO.: 4), the LCDR1 region of sequence SGDSIGKKYAY (SEQ ID NO.: 5), the LCDR2 region of sequence KKRPS (SEQ ID NO.: 6), and the LCDR3 region of sequence SAWGDKGM (SEQ ID NO.: 7).

2. The method according to claim 1 , wherein the anti-GM-CSF antibody comprises the variable heavy chain peptide of sequence:

(SEQ ID NO: 8)

QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSG

IENKYAGGATYYAASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

GFGTDFWGQGTLVTVSS

and the variable light chain peptide of sequence:

(SEQ ID NO: 9)

DIELTQPPSVSVAPGQTARISCSGDSIGKKYAYWYQQKPGQAPVLVIYKK

RPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSAWGDKGMVFGGGTK

LTVLGQ.

3. The method according to claim 1 , wherein the patient is administered a dose of 1 mg/kg, 1.5 mg/kg, 2.0 mg/kg, 2.5 mg/kg, 3.0 mg/kg, 3.5 mg/kg, or 4.0 mg/kg of the anti-GM-CSF antibody.

4. The method according to claim 1 , wherein the patient is administered a dose of 40 mg to 400 mg of the anti-GM-CSF antibody.

5. The method according to claim 1 , wherein the patient is administered a dose of 75 mg, 100 mg, 150 mg, 180 mg, 200 mg, 300 mg, or 400 mg of the anti-GM-CSF antibody.

6. The method according to claim 1 , wherein the patient is administered a dose of 150 mg of the anti-GM-CSF antibody.

7. The method according to claim 1 , wherein the pharmaceutical composition is administered subcutaneously.

Assignees

• Morphosys Ag

Inventors

• Hartle Stefan
• Leclair Stephane
• Shebl Amgad
• Steidl Stefan
• Brocks Bodo
• Ducata Daniela Della
• Rosport Kai

Classifications

• A61K2300/00

  Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00 · CPC title

• A61K31/519

  ortho- or peri-condensed with heterocyclic rings · CPC title

• C07K16/243 Primary

  Colony Stimulating Factors · CPC title

• C07K2317/21

  from primates, e.g. man · CPC title

• A61P19/02

  for joint disorders, e.g. arthritis, arthrosis · CPC title