Combination therapies using anti-pseudomonas PSL and PCRV binding molecules

US10597439B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-10597439-B2
Application numberUS-201214356500-A
CountryUS
Kind codeB2
Filing dateNov 6, 2012
Priority dateNov 7, 2011
Publication dateMar 24, 2020
Grant dateMar 24, 2020

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

This disclosure relates to combination therapies comprising anti-Pseudomonas Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of Pseudomonas infection.

First claim

Opening claim text (preview).

What is claimed is: 1. A bispecific antibody or antigen-binding fragment thereof comprising a binding domain that binds to Pseudomonas Psl and a binding domain that binds to Pseudomonas PcrV, wherein the domain that binds to Pseudomonas Psl comprises: a heavy chain CDR1 comprising amino acids PYYWT (SEQ ID NO:47); a heavy chain CDR2 comprising amino acids YIHSSGYTDYNPSLKS (SEQ ID NO:48); a heavy chain CDR3 comprising amino acids ADWDRLRALDI (SEQ ID NO:258); a light chain CDR1 comprising amino acids RASQSIRSHLN (SEQ ID NO:50); a light chain CDR2 comprising amino acids GASNLQS (SEQ ID NO:51); and a light chain CDR3 comprising amino acids QQSTGAWNW (SEQ ID NO:280); and wherein the domain that binds to Pseudomonas PcrV comprises: a heavy chain CDR1 comprising amino acids SYAMN (SEQ ID NO:218); a heavy chain CDR2 comprising amino acids AITMSGITAYYTDDVKG (amino acids 50-66 of SEQ ID NO:264); a heavy chain CDR3 comprising amino acids EEFLPGTHYYYGMDV (SEQ ID NO:220); a light chain CDR1 comprising amino acids RASQGIRNDLG (SEQ ID NO:221); a light chain CDR2 comprising amino acids SASTLQS (SEQ ID NO:222); and a light chain CDR3 comprising amino acids LQDYNYPWT (SEQ ID NO:223). 2. The bispecific antibody or antigen-binding fragment thereof of claim 1 , wherein the binding domain that binds to Psl comprises amino acids: QVQLQESGPGLVKPSETLSLTCTVSGGSISPYYWTWI RQPPGKCLELIGYI HSSGYT DYNPSLKSRVTISGDTSKKQFSLKLSSVTAADTAVYYCARADWDRLRALDIWGQGTMVTVS SGGGGSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCRASQSIRSHLNWYQQ KPGKAPKLLIYGASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSTGAWNWF GCGTKVEIK (SEQ ID NO:262). 3. The bispecific antibody of or antigen-binding fragment thereof claim 1 , wherein the binding domain that binds to Pseudomonas PcrV comprises: a heavy chain variable region (VH) comprising amino acids: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSAITMSGITAYY TDDVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEFLPGTHYYYGMDVWGQGTTV TVSS (amino acids 1-124 OF SEQ ID NO:264); and a light chain variable region (VL) comprising amino acids: AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYSASTLQSGVPSR FSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPWTFGQGTKVEIK (amino acids 1-107 OF SEQ ID NO:263). 4. The bispecific antibody or antigen-binding fragment thereof of claim 1 , wherein the binding domain that binds to Psl comprises amino acids: QVQLQESGPGLVKPSETLSLTCTVSGGSISPYYWTWIRQPPGKCLELIGYIHSSGYT DYNPSLKSRVTISGDTSKKQFSLKLSSVTAADTAVYYCARADWDRLRALDIWGQGTMVTVS SGGGGSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCRASQSIRSHLNWYQQ KPGKAPKLLIYGASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSTGAWNWF GCGTKVEIK (SEQ ID NO:262); and wherein the binding domain that binds to Pseudomonas PcrV comprises: a heavy chain variable region (VH) comprising amino acids: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSAITMSGITAYY TDDVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEFLPGTHYYYGMDVWGQGTTV TVSS (amino acids 1-124 of SEQ ID NO:264); and a light chain variable region (VL) comprising amino acids: AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYSASTLQSGVPSR FSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPWTFGQGTKVEIK (amino acids 1-107 of SEQ ID NO:263). 5. A composition comprising the bispecific antibody or fragment thereof of claim 1 , and a pharmaceutically acceptable carrier. 6. A bispecific antibody comprising a binding domain that binds to Pseudomonas Psl and a binding domain that binds to Pseudomonas PcrV, wherein the bispecific antibody comprises a heavy chain comprising SEQ ID NO:264 and a light chain comprising SEQ ID NO:263. 7. A composition comprising the bispecific antibody or fragment thereof of claim 6 , and a pharmaceutically acceptable carrier.

Assignees

Inventors

Classifications

  • Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title

  • comprising antibodies · CPC title

  • multispecific · CPC title

  • Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity · CPC title

  • Pseudomonadaceae (F) · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US10597439B2 cover?
This disclosure relates to combination therapies comprising anti-Pseudomonas Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of Pseudomonas infection.
Who is the assignee on this patent?
Medimmune Llc, Medimmune Ltd
What technology area does this patent fall under?
Primary CPC classification C07K16/1214. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Mar 24 2020 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 12 related publications on this page (citations in our corpus or others sharing the same primary CPC).