Antibodies to S. aureus surface determinants
US-9879070-B2 · Jan 30, 2018 · US
US10597439B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10597439-B2 |
| Application number | US-201214356500-A |
| Country | US |
| Kind code | B2 |
| Filing date | Nov 6, 2012 |
| Priority date | Nov 7, 2011 |
| Publication date | Mar 24, 2020 |
| Grant date | Mar 24, 2020 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
This disclosure relates to combination therapies comprising anti-Pseudomonas Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of Pseudomonas infection.
Opening claim text (preview).
What is claimed is: 1. A bispecific antibody or antigen-binding fragment thereof comprising a binding domain that binds to Pseudomonas Psl and a binding domain that binds to Pseudomonas PcrV, wherein the domain that binds to Pseudomonas Psl comprises: a heavy chain CDR1 comprising amino acids PYYWT (SEQ ID NO:47); a heavy chain CDR2 comprising amino acids YIHSSGYTDYNPSLKS (SEQ ID NO:48); a heavy chain CDR3 comprising amino acids ADWDRLRALDI (SEQ ID NO:258); a light chain CDR1 comprising amino acids RASQSIRSHLN (SEQ ID NO:50); a light chain CDR2 comprising amino acids GASNLQS (SEQ ID NO:51); and a light chain CDR3 comprising amino acids QQSTGAWNW (SEQ ID NO:280); and wherein the domain that binds to Pseudomonas PcrV comprises: a heavy chain CDR1 comprising amino acids SYAMN (SEQ ID NO:218); a heavy chain CDR2 comprising amino acids AITMSGITAYYTDDVKG (amino acids 50-66 of SEQ ID NO:264); a heavy chain CDR3 comprising amino acids EEFLPGTHYYYGMDV (SEQ ID NO:220); a light chain CDR1 comprising amino acids RASQGIRNDLG (SEQ ID NO:221); a light chain CDR2 comprising amino acids SASTLQS (SEQ ID NO:222); and a light chain CDR3 comprising amino acids LQDYNYPWT (SEQ ID NO:223). 2. The bispecific antibody or antigen-binding fragment thereof of claim 1 , wherein the binding domain that binds to Psl comprises amino acids: QVQLQESGPGLVKPSETLSLTCTVSGGSISPYYWTWI RQPPGKCLELIGYI HSSGYT DYNPSLKSRVTISGDTSKKQFSLKLSSVTAADTAVYYCARADWDRLRALDIWGQGTMVTVS SGGGGSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCRASQSIRSHLNWYQQ KPGKAPKLLIYGASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSTGAWNWF GCGTKVEIK (SEQ ID NO:262). 3. The bispecific antibody of or antigen-binding fragment thereof claim 1 , wherein the binding domain that binds to Pseudomonas PcrV comprises: a heavy chain variable region (VH) comprising amino acids: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSAITMSGITAYY TDDVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEFLPGTHYYYGMDVWGQGTTV TVSS (amino acids 1-124 OF SEQ ID NO:264); and a light chain variable region (VL) comprising amino acids: AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYSASTLQSGVPSR FSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPWTFGQGTKVEIK (amino acids 1-107 OF SEQ ID NO:263). 4. The bispecific antibody or antigen-binding fragment thereof of claim 1 , wherein the binding domain that binds to Psl comprises amino acids: QVQLQESGPGLVKPSETLSLTCTVSGGSISPYYWTWIRQPPGKCLELIGYIHSSGYT DYNPSLKSRVTISGDTSKKQFSLKLSSVTAADTAVYYCARADWDRLRALDIWGQGTMVTVS SGGGGSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCRASQSIRSHLNWYQQ KPGKAPKLLIYGASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSTGAWNWF GCGTKVEIK (SEQ ID NO:262); and wherein the binding domain that binds to Pseudomonas PcrV comprises: a heavy chain variable region (VH) comprising amino acids: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSAITMSGITAYY TDDVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEFLPGTHYYYGMDVWGQGTTV TVSS (amino acids 1-124 of SEQ ID NO:264); and a light chain variable region (VL) comprising amino acids: AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYSASTLQSGVPSR FSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPWTFGQGTKVEIK (amino acids 1-107 of SEQ ID NO:263). 5. A composition comprising the bispecific antibody or fragment thereof of claim 1 , and a pharmaceutically acceptable carrier. 6. A bispecific antibody comprising a binding domain that binds to Pseudomonas Psl and a binding domain that binds to Pseudomonas PcrV, wherein the bispecific antibody comprises a heavy chain comprising SEQ ID NO:264 and a light chain comprising SEQ ID NO:263. 7. A composition comprising the bispecific antibody or fragment thereof of claim 6 , and a pharmaceutically acceptable carrier.
Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title
comprising antibodies · CPC title
multispecific · CPC title
Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity · CPC title
Pseudomonadaceae (F) · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.