Plasma kallikrein binding proteins
US-2018037665-A1 · Feb 8, 2018 · US
US10370453B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10370453-B2 |
| Application number | US-201514969498-A |
| Country | US |
| Kind code | B2 |
| Filing date | Dec 15, 2015 |
| Priority date | Jan 6, 2011 |
| Publication date | Aug 6, 2019 |
| Grant date | Aug 6, 2019 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
Plasma kallikrein binding proteins and methods of using such proteins are described.
Opening claim text (preview).
We claim: 1. A method of treating edema in a subject, the method comprising: administering an antibody that binds to the active form of human plasma kallikrein to a subject in need thereof, wherein the antibody comprises: (i) a heavy chain variable region comprising a complementary determining region (CDR) 1 set forth as HYIMM (SEQ ID NO: 166), a CDR2 set forth as GIYSSGGITVYADSVKG (SEQ ID NO: 167), and a CDR3 set forth as RRIGVPRRDEFDI (SEQ ID NO: 1171) or RRTGVPRWDDFDI (SEQ ID NO: 1177); and (ii) a light chain variable region comprising a CDR1 set forth as RASQSISSWLA (SEQ ID NO: 1172), a CDR2 set forth as KASTLES (SEQ ID NO: 1173), and a CDR3 set forth as QQYNTYWT (SEQ ID NO: 1174). 2. The method of claim 1 , wherein the heavy chain variable region of the antibody comprises the amino acid sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTV SS (SEQ ID NO: 2410) or EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGK GLEWVSGIYSSGGITVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAFRRTGVP RWDDFDIWGQGTMVTVSSASTKGPSVFPLAPSSKS (SEQ ID NO: 1801), and the light chain variable region of the antibody comprises the amino acid sequence of DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVPSRF SGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK (SEQ ID NO: 2394). 3. The method of claim 1 , wherein the heavy chain variable region of the antibody comprises the amino acid sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTV SS (SEQ ID NO: 2410) or EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGK GLEWVSGIYSSGGITVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAFRRTGVP RWDDFDIWGQGTMVTVSSASTKGPSVFPLAPSSKS (SEQ ID NO: 1801), and the light chain variable region of the antibody comprises the amino acid sequence of DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVPSRF SGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEI (SEQ ID NO: 2395). 4. The method of claim 1 , wherein the antibody is a full-length antibody. 5. The method of claim 4 , wherein the antibody is an IgG molecule. 6. The method of claim 1 , wherein the antibody is an antigen-binding fragment of a full-length antibody. 7. The method of claim 1 , wherein the subject is a human patient having or at risk for edema. 8. The method of claim 1 , wherein the edema is hereditary angioedema. 9. The method of claim 7 , wherein the edema is hereditary angioedema.
Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title
Drugs for immunological or allergic disorders · CPC title
for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis · CPC title
Drugs for disorders of the cardiovascular system · CPC title
Antioedematous agents; Diuretics · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.