Methods and materials for identifying and treating membranous nephropathy
US-2024353404-A1 · Oct 24, 2024 · US
Method of treating hereditary angioedema using plasma kallikrein binding antibodies
US9266964B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-9266964-B2 |
| Application number | US-201414310814-A |
| Country | US |
| Kind code | B2 |
| Filing date | Jun 20, 2014 |
| Priority date | Jan 6, 2011 |
| Publication date | Feb 23, 2016 |
| Grant date | Feb 23, 2016 |
How to read this patent
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
- Title
What the patent document calls the invention.
- Abstract
A short plain-language summary of the technical disclosure.
- Assignees and inventors
Who owns or filed the patent and who is credited as inventor.
- Key dates
Filing, priority, publication, and grant dates set the timeline.
- First independent claim
The legal scope of protection — read this for what is actually claimed.
- CPC / IPC classifications
Technology tags used to group this patent with similar filings.
- Citations and related patents
Prior art links and similar publications in this corpus.
Abstract
Official abstract text for this publication.
Plasma kallikrein binding proteins and methods of using such proteins are described.
First claim
Opening claim text (preview).
We claim: 1. A method of treating a plasma kallikrein associated disorder in a subject, the method comprising: administering to the subject an antibody that binds to the active form of human plasma kallikrein; wherein the antibody comprises: (i) a heavy chain variable region comprising a complementary determining region (CDR) 1 set forth as HYIMM (SEQ ID NO: 166), a CDR2 set forth as GIYSSGGITVYADSVKG (SEQ ID NO: 167), and a CDR3 set forth as RRIGVPRRDEFDI (SEQ ID NO: 1171); and (ii) a light chain variable region comprising a CDR1 set forth as RASQSISSWLA (SEQ ID NO: 1172), a CDR2 set forth as KASTLES (SEQ ID NO: 1173), and a CDR3 set forth as QOYNTYWT (SEQ ID NO: 1174); wherein the plasma kallikrein associated disorder is hereditary angioedema. 2. The method of claim 1 , wherein the heavy chain variable region of the antibody comprises the amino acid sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTV SS (SEQ ID NO: 2410), and the light chain variable region of the antibody comprises the amino acid sequence of DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVPSRF SGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK (SEQ ID NO: 2394). 3. The method of claim 1 , wherein the heavy chain variable region of the antibody comprises the amino acid sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGI TVY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTM VTV SS (SEQ ID NO: 2410), and the light chain variable region of the antibody comprises the amino acid sequence of DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVP SRF SGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEI (SEQ ID NO: 2395). 4. The method of claim 1 , wherein the antibody is a full-length antibody. 5. The method of claim 4 , wherein the antibody is an IgG molecule. 6. The method of claim 1 , wherein the antibody is an antigen-binding fragment of a full-length antibody.
Assignees
Inventors
Classifications
Drugs for immunological or allergic disorders · CPC title
Drugs for disorders of the cardiovascular system · CPC title
Antineoplastic agents · CPC title
Antioedematous agents; Diuretics · CPC title
Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title
Patent family
Related publications grouped by family.
External sources
Frequently asked questions
Answers are generated from the same data shown on this page.
- What does patent US9266964B2 cover?
- Plasma kallikrein binding proteins and methods of using such proteins are described.
- Who is the assignee on this patent?
- Dyax Corp
- What technology area does this patent fall under?
- Primary CPC classification C07K16/40. Mapped technology areas include Chemistry & Metallurgy.
- When was this patent published?
- Publication date Tue Feb 23 2016 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
- What related patents are in patentsdb?
- We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).