Compositions and methods relating to universal glycoforms for enhanced antibody efficacy

Patent metadata

Field	Value
Publication number	US-10118969-B2
Application number	US-201615011544-A
Country	US
Kind code	B2
Filing date	Jan 30, 2016
Priority date	May 27, 2014
Publication date	Nov 6, 2018
Grant date	Nov 6, 2018

Abstract

The present disclosure relates to compositions and methods of use comprising antibodies or binding fragments thereof further comprising universal Fc glycoforms.

First claim

What is claimed is:

1. An isolated monoclonal antibody or antigen-binding fragment thereof that binds to Neu5Acα2→3Galβ1→3GalNAcβ1→3Galα1→4Galβ1→4Glcβ1, wherein the antibody or antigen-binding fragment thereof comprises a glycan attached to Asn-297 of the Fc region, wherein the glycan has the formula:
Sia 2 ( α2-6)Gal 2 GlcNAc 2 Man 3 GlcNAc 2 , as in the structure shown in FIG. 1 , and wherein the antibody or antigen-binding fragment thereof comprises an H-CDR1, an H-CDR2, an H-CDR3, an L-CDR1, an L-CDR2, and an L-CDR3, wherein:
(i) the H-CDR1 comprises the sequence of SEQ ID NO:152 (GFSLTSYG);
(ii) the H-CDR2 comprises the sequence of SEQ ID NO:153 (IWGEGST);
(iii) the H-CDR3 comprises the sequence of SEQ ID NO:154 (AMTGTAY);
(iv) the L-CDR1 comprises the sequence of SEQ ID NO:149 (SSVSY);
(v) the L-CDR2 comprises the sequence of SEQ ID NO:150 (DTS); and
(vi) the L-CDR3 comprises the sequence of SEQ ID NO:151(HQWSSSPHT).

2. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1 , wherein the antibody is an IgG1.

3. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 2 wherein the antibody comprises a VH having SEQ ID NO:147 and a VL having SEQ ID No:148.

4. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1 wherein the antibody is a humanized antibody.

5. A pharmaceutical composition comprising the isolated monoclonal antibody or antigen-binding fragment thereof of claim 1 and a pharmaceutically acceptable carrier.

6. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 2 , wherein the antibody comprises a VH having SEQ ID NO:137 and a VL having SEQ ID NO:138.

7. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1 , wherein the antibody or antigen-binding fragment thereof further comprises an H-FR1, an H-FR2, an H-FR3, an HFR4, an L-FR1, an L-FR2, an L-FR3, and an L-FR4, wherein:
(i) the H-FR1 comprises the sequence of SEQ ID NO: 159 (QVQLKESGPGLVAPSQSLSITCTVS);
(ii) the H-FR2 comprises the sequence of SEQ ID NO:160 (VSWIRQPPGKGLEWIGV);
(iii) the H-FR3 comprises the sequence of SEQ ID NO:161 (NYHSVLISRLTISKDNSKSQVFLKLNSLQTDDTATYYC);
(iv) the H-FR4 comprises the sequence of SEQ ID NO:162 (WGQGTLVTVSS);
(v) the L-FR1 comprises the sequence of SEQ ID NO:155 (QIVLTQSPAIMSASPGEKVTMTCSAS);
(vi) the L-FR2 comprises the sequence of SEQ ID NO 156 (MHWYQQKSGTSPKRWIY);
(vii) the L-FR3 comprises the sequence of SEQ ID NO:157 (KLSSGVPGRFSGSGSGTSYSLTISRLEAEDAATYYC); and
(viii) the L-FR4 comprises the sequence of SEQ ID NO:158 (FGGGTKVEIKR).

8. An isolated monoclonal antibody or antigen-binding fragment thereof that binds to Neu5Acα2→3Galβ1→3GalNAcβ1→3Galα1→4Galβ1→4Glcβ1, wherein the antibody or antigen-binding fragment thereof comprises a glycan attached to Asn-297 of the Fc region, wherein the glycan has the formula:
Sia 2 (α2-6)Gal 2 GlcNAc 2 Man 3 GlcNAc 2 , as in the structure shown in FIG. 1 , and wherein the antibody or antigen-binding fragment thereof comprises an H-CDR1, an H-CDR2, an H-CDR3, an L-CDR1, an L-CDR2, and an L-CDR3, wherein:
(i) the H-CDR1 comprises the sequence of SEQ ID NO:207;
(ii) the H-CDR2 comprises the sequence of SEQ ID NO:208;
(iii) the H-CDR3 comprises the sequence of SEQ ID NO:209;
(iv) the L-CDR1 comprises the sequence of SEQ ID NO:204;
(v) the L-CDR2 comprises the sequence of SEQ ID NO:205; and
(vi) the L-CDR3 comprises the sequence of SEQ ID NO:206.

9. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 8 , wherein the antibody is a humanized antibody.

10. The isolated monoclonal antibody of claim 8 , wherein the monoclonal antibody or antigen-binding fragment thereof comprises a VH having SEQ ID NO:202 and a VL having SEQ ID No:203.

11. A pharmaceutical composition comprising the isolated monoclonal antibody or antigen-binding fragment thereof of claim 8 and a pharmaceutically acceptable carrier.

12. An isolated monoclonal antibody or antigen-binding fragment thereof that binds to Neu5Acα2→3Galβ1→3GalNAcβ1→3Galα1→4Galβ1→4Glcβ1, wherein the antibody or antigen-binding fragment thereof comprises a glycan attached to Asn-297 of the Fc region, wherein the glycan has the formula:
Sia 2 (α2-6)Gal 2 GlcNAc 2 Man 3 GlcNAc 2 , as in the structure shown in FIG. 1 , and wherein the antibody or antigen-binding fragment thereof comprises an H-CDR1, an H-CDR2, an H-CDR3, an L-CDR1, an L-CDR2, and an L-CDR3, wherein:
(i) the H-CDR1 comprises the sequence of SEQ ID NO:217;
(ii) the H-CDR2 comprises the sequence of SEQ ID NO:218;
(iii) the H-CDR3 comprises the sequence of SEQ ID NO:219;
(iv) the L-CDR1 comprises the sequence of SEQ ID NO:214;
(v) the L-CDR2 comprises the sequence of SEQ ID NO:215; and
(vi) the L-CDR3 comprises the sequence of SEQ ID NO:216.

13. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 12 , wherein the antibody is a humanized antibody.

14. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 12 , wherein the antibody comprises a VH having SEQ ID NO:212 and a VL having SEQ ID NO:213.

15. A pharmaceutical composition comprising the isolated monoclonal antibody or antigen-binding fragment thereof of claim 12 and a pharmaceutically acceptable carrier.

16. An isolated monoclonal antibody or antigen-binding fragment thereof that binds to Neu5Acα2→3Galβ1→3GalNAcβ1→3Galαl→4Galβ1→4Glcβ1, wherein the antibody or the antigen-binding fragment thereof comprises a glycan attached to Asn-297 of the Fc region, wherein the glycan has the formula:
Sia 2 (α2-6)Gal 2 GlcNAc 2 Man 3 GlcNAc 2 , as in the structure shown in FIG. 1 , and wherein the antibody or antigen-binding fragment thereof comprises an H-CDR1, an H-CDR2, an H-CDR3, an L-CDR1, an L-CDR2, and an L-CDR3, wherein:
(i) the H-CDR1 comprises the sequence of SEQ ID NO:227;
(ii) the H-CDR2 comprises the sequence of SEQ ID NO:228;
(iii) the H-CDR3 comprises the sequence of SEQ ID NO:229;
(iv) the L-CDR1 comprises the sequence of SEQ ID NO:224;
(v) the L-CDR2 comprises the sequence of SEQ ID NO:225; and
(vi) the L-CDR3 comprises the sequence of SEQ ID NO:226.

17. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 16 , wherein the antibody is a humanized antibody.

18. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 16 , wherein the antibody comprises a VH having SEQ ID NO:222 and a VL having SEQ ID NO:223.

19. A pharmaceutical composition comprising the isolated monoclonal antibody or antigen-binding fragment thereof of claim 16 and a pharmaceutically acceptable carrier.

Assignees

• Academia Sinica

Inventors

• Wong Chi-Huey
• Wu Chung-Yi
• Ma Che
• Wu Han-Chung

Classifications

• C07K16/108

  Orthomyxoviridae (F), e.g. influenza virus · CPC title

• C07K16/18

  against material from animals or humans · CPC title

• C07K16/1018

  Chemistry & Metallurgy · mapped topic

• C07K2317/52

  Constant or Fc region; Isotype · CPC title

• C12N9/24

  acting on glycosyl compounds (3.2) · CPC title