Extracellular matrix-binding synthetic peptidoglycans

US9872887B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-9872887-B2
Application numberUS-201514940990-A
CountryUS
Kind codeB2
Filing dateNov 13, 2015
Priority dateMar 15, 2013
Publication dateJan 23, 2018
Grant dateJan 23, 2018

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

This disclosure provides extracellular matrix-binding synthetic peptidoglycans comprised of one or more synthetic peptides conjugated to a glycan and methods of their use.

First claim

Opening claim text (preview).

What is claimed is: 1. A method of treating and/or preventing osteoarthritis in a joint of a patient, comprising injecting to the joint an extracellular matrix-binding synthetic peptidoglycan comprising: a) a glycan; b) from about 1 to about 80 collagen binding peptide(s); and c) from about 1 to about 80 hyaluronic acid binding peptide(s); wherein the peptides of b) and c) are covalently bonded to the glycan. 2. The method of claim 1 , wherein the glycan is dextran, chondroitin, chondroitin sulfate, dermatan, dermatan sulfate, heparan, heparin, keratin, keratan sulfate, or hyaluronic acid. 3. The method of claim 1 , wherein the glycan is dermatan sulfate. 4. The method of claim 1 , wherein the glycan is chondroitin sulfate. 5. The method of claim 1 , wherein the glycan is hyaluronic acid. 6. The method of claim 1 , wherein the peptides are covalently bonded to the glycan via a linker. 7. The method of claim 6 , wherein the linker is N[β-maleimidopropionic acid]hydrazide (BMPH). 8. The method of claim 1 , wherein the synthetic peptidoglycan comprises a total of less than about 50 peptides. 9. The method of claim 1 , wherein the synthetic peptidoglycan comprises a total of from about 10 to about 40 peptides. 10. The method of claim 1 , wherein the synthetic peptidoglycan comprises a total of about 22 peptides. 11. The method of claim 1 , wherein the collagen binding peptide has binding affinity to one or more of collagen types I, II, III, or IV. 12. The method of claim 1 , wherein the collagen binding peptide comprises at least one collagen binding peptide that binds to type I collagen and at least one collagen binding peptide that binds to type II collagen. 13. The method of claim 1 , wherein the collagen binding peptide comprises an amino acid sequence selected from the group consisting of: i) (SEQ ID NO: 81) WYRGRLGC, (SEQ ID NO: 68) RRANAALKAGELYKSILYGC, (SEQ ID NO: 69) RLDGNEIKRGC, (SEQ ID NO: 70) AHEEISTTNEGVMGC, (SEQ ID NO: 71) GCGGELYKSILY, (SEQ ID NO: 72) NGVFKYRPRYFLYKHAYFYPPLKRFPVQGC, (SEQ ID NO: 60) CQDSETRTFY, (SEQ ID NO: 74) TKKTLRTGC, (SEQ ID NO: 75) GLRSKSKKFRRPDIQYPDATDEDITSHMGC, (SEQ ID NO: 76) SQNPVQPGC, (SEQ ID NO: 77) SYIRIADTNITGC, (SEQ ID NO: 64) SYIRIADTNIT, (SEQ ID NO: 65) KELNLVYT, (SEQ ID NO: 78) KELNLVYTGC, (SEQ ID NO: 67) GSITTIDVPWNV, (SEQ ID NO: 80) GELYKSILYGC  and (SEQ ID NO: 66) GSITTIDVPWNVGC, or ii) any peptide sequence comprising a sequence with at least about 80% sequence identity to the amino acid sequence of i). 14. The method of claim 1 , wherein the collagen binding peptide is WYRGRLGC (SEQ ID NO: 81), RRANAALKAGELYKSILYGC (SEQ ID NO: 68), RLDGNEIKRGC (SEQ ID NO: 69), AHEEISTTNEGVMGC (SEQ ID NO: 70), GCGGELYKSILY (SEQ ID NO: 71), NGVFKYRPRYFLYKHAYFYPPLKRFPVQGC (SEQ ID NO: 72), CQDSETRTFY (SEQ ID NO: 60), TKKTLRTGC (SEQ ID NO: 74), GLRSKSKKFRRPDIQYPDATDEDITSHMGC (SEQ ID NO: 75), SQNPVQPGC (SEQ ID NO: 76), SYIRIADTNITGC (SEQ ID NO: 77), SYIRIADTNIT (SEQ ID NO: 64), KELNLVYT (SEQ ID NO: 65), KELNLVYTGC (SEQ ID NO: 78), GSITTIDVPWNV (SEQ ID NO: 67), GELYKSILYGC (SEQ ID NO: 80) or GSITTIDVPWNVGC (SEQ ID NO: 66). 15. The method of claim 1 , wherein the collagen binding peptide is WYRGRLGC (SEQ ID NO: 81), or a peptide sequence comprising a sequence with at least about 80% sequence identity to SEQ ID NO: 81. 16. The method of claim 1 , wherein the hyaluronic acid binding peptide comprises an amino acid sequence selected from the group consisting of:

Assignees

Inventors

Classifications

  • Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title

  • Ophthalmic agents · CPC title

  • Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID] · CPC title

  • for bone diseases, e.g. rachitism, Paget's disease · CPC title

  • Emollients or protectives, e.g. against radiation · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US9872887B2 cover?
This disclosure provides extracellular matrix-binding synthetic peptidoglycans comprised of one or more synthetic peptides conjugated to a glycan and methods of their use.
Who is the assignee on this patent?
Purdue Research Foundation
What technology area does this patent fall under?
Primary CPC classification A61K38/14. Mapped technology areas include Human Necessities.
When was this patent published?
Publication date Tue Jan 23 2018 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 5 related publications on this page (citations in our corpus or others sharing the same primary CPC).