Collagen binding synthetic peptidoglycans for treatment of endothelial dysfunction
US-2017043023-A1 · Feb 16, 2017 · US
US9872887B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-9872887-B2 |
| Application number | US-201514940990-A |
| Country | US |
| Kind code | B2 |
| Filing date | Nov 13, 2015 |
| Priority date | Mar 15, 2013 |
| Publication date | Jan 23, 2018 |
| Grant date | Jan 23, 2018 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
This disclosure provides extracellular matrix-binding synthetic peptidoglycans comprised of one or more synthetic peptides conjugated to a glycan and methods of their use.
Opening claim text (preview).
What is claimed is: 1. A method of treating and/or preventing osteoarthritis in a joint of a patient, comprising injecting to the joint an extracellular matrix-binding synthetic peptidoglycan comprising: a) a glycan; b) from about 1 to about 80 collagen binding peptide(s); and c) from about 1 to about 80 hyaluronic acid binding peptide(s); wherein the peptides of b) and c) are covalently bonded to the glycan. 2. The method of claim 1 , wherein the glycan is dextran, chondroitin, chondroitin sulfate, dermatan, dermatan sulfate, heparan, heparin, keratin, keratan sulfate, or hyaluronic acid. 3. The method of claim 1 , wherein the glycan is dermatan sulfate. 4. The method of claim 1 , wherein the glycan is chondroitin sulfate. 5. The method of claim 1 , wherein the glycan is hyaluronic acid. 6. The method of claim 1 , wherein the peptides are covalently bonded to the glycan via a linker. 7. The method of claim 6 , wherein the linker is N[β-maleimidopropionic acid]hydrazide (BMPH). 8. The method of claim 1 , wherein the synthetic peptidoglycan comprises a total of less than about 50 peptides. 9. The method of claim 1 , wherein the synthetic peptidoglycan comprises a total of from about 10 to about 40 peptides. 10. The method of claim 1 , wherein the synthetic peptidoglycan comprises a total of about 22 peptides. 11. The method of claim 1 , wherein the collagen binding peptide has binding affinity to one or more of collagen types I, II, III, or IV. 12. The method of claim 1 , wherein the collagen binding peptide comprises at least one collagen binding peptide that binds to type I collagen and at least one collagen binding peptide that binds to type II collagen. 13. The method of claim 1 , wherein the collagen binding peptide comprises an amino acid sequence selected from the group consisting of: i) (SEQ ID NO: 81) WYRGRLGC, (SEQ ID NO: 68) RRANAALKAGELYKSILYGC, (SEQ ID NO: 69) RLDGNEIKRGC, (SEQ ID NO: 70) AHEEISTTNEGVMGC, (SEQ ID NO: 71) GCGGELYKSILY, (SEQ ID NO: 72) NGVFKYRPRYFLYKHAYFYPPLKRFPVQGC, (SEQ ID NO: 60) CQDSETRTFY, (SEQ ID NO: 74) TKKTLRTGC, (SEQ ID NO: 75) GLRSKSKKFRRPDIQYPDATDEDITSHMGC, (SEQ ID NO: 76) SQNPVQPGC, (SEQ ID NO: 77) SYIRIADTNITGC, (SEQ ID NO: 64) SYIRIADTNIT, (SEQ ID NO: 65) KELNLVYT, (SEQ ID NO: 78) KELNLVYTGC, (SEQ ID NO: 67) GSITTIDVPWNV, (SEQ ID NO: 80) GELYKSILYGC and (SEQ ID NO: 66) GSITTIDVPWNVGC, or ii) any peptide sequence comprising a sequence with at least about 80% sequence identity to the amino acid sequence of i). 14. The method of claim 1 , wherein the collagen binding peptide is WYRGRLGC (SEQ ID NO: 81), RRANAALKAGELYKSILYGC (SEQ ID NO: 68), RLDGNEIKRGC (SEQ ID NO: 69), AHEEISTTNEGVMGC (SEQ ID NO: 70), GCGGELYKSILY (SEQ ID NO: 71), NGVFKYRPRYFLYKHAYFYPPLKRFPVQGC (SEQ ID NO: 72), CQDSETRTFY (SEQ ID NO: 60), TKKTLRTGC (SEQ ID NO: 74), GLRSKSKKFRRPDIQYPDATDEDITSHMGC (SEQ ID NO: 75), SQNPVQPGC (SEQ ID NO: 76), SYIRIADTNITGC (SEQ ID NO: 77), SYIRIADTNIT (SEQ ID NO: 64), KELNLVYT (SEQ ID NO: 65), KELNLVYTGC (SEQ ID NO: 78), GSITTIDVPWNV (SEQ ID NO: 67), GELYKSILYGC (SEQ ID NO: 80) or GSITTIDVPWNVGC (SEQ ID NO: 66). 15. The method of claim 1 , wherein the collagen binding peptide is WYRGRLGC (SEQ ID NO: 81), or a peptide sequence comprising a sequence with at least about 80% sequence identity to SEQ ID NO: 81. 16. The method of claim 1 , wherein the hyaluronic acid binding peptide comprises an amino acid sequence selected from the group consisting of:
Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title
Ophthalmic agents · CPC title
Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID] · CPC title
for bone diseases, e.g. rachitism, Paget's disease · CPC title
Emollients or protectives, e.g. against radiation · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.