Composition and uses thereof

Patent metadata

Field	Value
Publication number	US-9821046-B2
Application number	US-201414762106-A
Country	US
Kind code	B2
Filing date	Jan 21, 2014
Priority date	Jan 21, 2013
Publication date	Nov 21, 2017
Grant date	Nov 21, 2017

Abstract

The present invention provides a particle comprising a fusion protein, wherein the fusion protein comprises at least one NANP repeat (SEQ ID NO: 7), some or all of the C-terminus of the CS protein from Plasmodium falciparum and a hepatitis B surface antigen, and wherein the particle comprises no, or substantially no, free hepatitis B surface antigen protein, and uses thereof.

First claim

The invention claimed is:

1. A virus-like particle comprising a fusion protein, wherein the fusion protein comprises at least one NANP repeat (SEQ ID NO: 7), and the C-terminus of the CS protein from Plasmodium falciparum comprising the sequence :

(SEQ ID NO: 6)

NKNNQGNGQGHNMPNDPNRNVDENANANSAVKNNNNEEPSDKIEKEYLN

KIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICK

MEKCSSVFN VVNSSIGI;

or the sequence

(SEQ ID NO: 4)

NKNNQGNGQGHNMPNDPNRNVDENANANSAVKNNNNEEPSDKHIKEYLN

KIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICK

MEKCSSV,

or a conservative substitution variant of SEQ ID No: 6 or SEQ ID NO: 4 with 95% or more sequence identity therewith; and HBsAg, wherein the virus-like particle comprises no free HBsAg.

2. The virus-like particle of claim 1 comprising at least 10 NANP repeats (SEQ ID NO: 13).

3. The virus-like particle of claim 1 , wherein the particle comprises at least about 40% or more by mass of its proteinaceous material, the proteinaceous material being derived from Plasmodium falciparum.

4. The virus-like particle of claim 1 comprising a fusion protein consisting of:
the sequence of SEQ ID NO: 1 (R21);
the sequence of SEQ ID NO: 2 (RTS); or
a sequence with at least 95%, or more sequence identity with the sequence of SEQ ID NO: 1 or SEQ ID NO: 2.

5. A fusion protein comprising at least one NANP repeat (SEQ ID NO: 7), and the C terminus of the CS protein from Plasmodium falciparum comprising the sequence :

(SEQ ID NO: 6)

NKNNQGNGQGHNMPNDPNRNVDENANANSAVKNNNNEEPSDKIEKEYLN

KIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICK

MEKCSSVFN VVNSSIGI;

or the sequence

(SEQ ID NO: 4)

NKNNQGNGQGHNMPNDPNRNVDENANANSAVKNNNNEEPSDKHIKEYLN

KIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICK

MEKCSSV;

or a conservative substitution variant of SEQ ID No: 6 or SEQ ID NO: 4 sequence with 95% or more sequence identity therewith; and HBsAg, wherein the fusion protein comprises no free HBsAg.

6. The fusion protein of claim 5 , wherein the fusion protein consists of, a sequence of SEQ ID NO: 1 (R21) or a sequence with at least 95% or more sequence identity with the sequence of SEQ ID NO: 1.

7. The fusion protein of claim 5 , wherein the fusion protein is expressed in a Saccharomyces cerevisiae or Pichia pastoris or a methylotrophic yeast cell.

8. The fusion protein of claim 7 , wherein the methylotrophic yeast cell is Hansenula polymoipha.

Assignees

• Univ Oxford Innovation Ltd

Inventors

• Collins Katharine Alice
• Gilbert Sarah Catharine
• Hill Adrian Vivian Sinton

Classifications

• A61K2039/70

  Multivalent vaccine · CPC title

• C12N2710/10041

  Use of virus, viral particle or viral elements as a vector · CPC title

• C07K16/205

  Plasmodium · CPC title

• C12N2710/24121

  Viruses as such, e.g. new isolates, mutants or their genomic sequences · CPC title

• C07K16/082

  Hepadnaviridae (F), e.g. hepatitis B virus · CPC title