Method for the treatment of multiple myeloma or non-Hodgkins lymphoma with anti-CD38 antibody and bortezomib or carfilzomib

Patent metadata

Field	Value
Publication number	US-9765152-B2
Application number	US-201615016330-A
Country	US
Kind code	B2
Filing date	Feb 5, 2016
Priority date	Sep 27, 2010
Publication date	Sep 19, 2017
Grant date	Sep 19, 2017

Abstract

A method of treating multiple myeloma or non-hodgkins lymphoma with a pharmaceutical composition comprising an anti-CD38 antibody and bortezomib or carfilzomib is disclosed.

First claim

We claim:

1. A method for treating multiple myeloma or non-hodgkins lymphoma in a subject in need thereof, wherein said method comprises administering to the subject a therapeutically effective amount of a combination of: (i) bortezomib or carfilzomib, (ii) an antibody specific for CD38, comprising an HCDR1 region of sequence SYYMN (SEQ ID NO: 14) or GFTFSSYYMN (SEQ ID NO: 1), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 2), an HCDR3 region of sequence DLPLVYTGFAY (SEQ ID NO: 3), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 4), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 5), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 6).

2. The method of claim 1 , wherein said antibody comprises an HCDR1 region of sequence SYYMN (SEQ ID NO: 14).

3. The method of claim 1 , wherein said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1).

4. The method of claim 1 , wherein said antibody comprises a variable heavy chain of the sequence:
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVS GISGDP SNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLPLVYT GF AYWGQGTLVTVSS (SEQ ID NO: 10);
and a variable light chain of the sequence:
DIELTQPPSVSVAPGQTARISCSGDNLRHYYVYWYQQKPGQAPVLVIYGD SKRPS GIPERFSGSNSGNTATLTISGTQAEDEADYYCQTYTGGASLVFGGGTKLT VLGQ (SEQ ID NO: 11).

5. The method of claim 1 , wherein said antibody is an IgG antibody.

6. The method of claim 1 , wherein said antibody comprises an IgG1 Fc region.

7. The method of claim 1 , wherein said antibody comprises a modified Fc region, wherein said modification enhances ADCC activity.

8. The method of claim 1 , wherein said combination comprises said antibody and bortezomib.

9. The method of claim 8 , wherein said cancer is multiple myeloma.

10. The method of claim 1 , wherein said combination comprises said antibody and carfilzomib.

11. The method of claim 10 , wherein said cancer is multiple myeloma.

12. The method of claim 1 , wherein said antibody and said bortezomib or carfilzomib are administered separately.

13. The method of claim 12 , wherein said antibody and said bortezomib are administered separately.

14. The method of claim 12 , wherein said antibody and said carfilzomib are administered separately.

Assignees

• Morphosys Ag

Inventors

• Rojkjaer Lisa
• Boxhammer Rainer
• Endell Jan
• Winderlich Mark
• Samuelsson Christofer

Classifications

• A61P35/02

  specific for leukemia · CPC title

• A61P35/00

  Antineoplastic agents · CPC title

• A61P43/00

  Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title

• A61K38/07

  Tetrapeptides · CPC title

• A61K31/454 Primary

  containing a five-membered ring with nitrogen as a ring hetero atom, e.g. pimozide, domperidone · CPC title