Tissue-directed antibodies and methods of using the same
US-2024342260-A1 · Oct 17, 2024 · US
US9688769B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-9688769-B2 |
| Application number | US-201414520904-A |
| Country | US |
| Kind code | B2 |
| Filing date | Oct 22, 2014 |
| Priority date | Oct 22, 2013 |
| Publication date | Jun 27, 2017 |
| Grant date | Jun 27, 2017 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
This invention relates generally to methods and compositions for diagnosing and treating disorders associated with elevated levels of Toll-like Receptor 4 (TLR4) ligands and other biomarkers. The invention also relates to methods of treating, delaying the progression of, or otherwise ameliorating a symptom of a disorder associated with elevated levels of TLR4 ligands and other biomarkers using agents that interfere with or otherwise antagonize TLR4 signaling, including neutralizing anti-TLR4 antibodies.
Opening claim text (preview).
What is claimed is: 1. A method of alleviating a symptom of a disorder associated with excessive aberrant TLR4 signaling or elevated TLR4 ligand expression or activity, wherein the disorder is an autoimmune or inflammatory disorder, the method comprising: (a) detecting a level of one or more TLR4 ligands or one or more other biomarkers selected from the group consisting of anti-citrullinated protein antibody (ACPA), a citrullinated fibrinogen (cFb) in an immune complex with an IgG protein (cFb-IC), HMGB1, S100A8/A9, Tenascin C, and combinations thereof in a biological sample from a subject, (b) comparing the detected level of the one or more TLR4 ligands or the one or more biomarkers to a control level of expression selected from the group consisting of: (i) a control level of expression for ACPA of 1000 μl/ml for monocyte response score or fibroblast response score in a synovial fluid sample or a control level of expression for ACPA of 330 μl/ml for combined monocyte and fibroblast response score (cMFRS), (ii) a control level of cFb-IC detected at OD 450 nm of 1.2 for monocyte response score or fibroblast response score in a synovial fluid sample or a control level of expression for cFb-IC detected at OD 450 nm of 0.55 for cMFRS, (iii) a control level of HMGB1 of 50 ng/ml for monocyte response score in a synovial fluid sample or a control level of HMGB1 of 45 ng/ml for cMFRS, (iv) a control level of S100A8/A9 of 387 ng/ml for monocyte response score or for cMFRS in a synovial fluid sample, (v) a control level of Tenascin C of 100 ng/ml for monocyte response score in a synovial fluid sample, (c) identifying the subject as a responder when the detected level of the one or more TLR4 ligands or one or more other biomarkers is greater than the control level of expression, or identifying the subject as a non-responder when the detected level of expression of the one or more TLR4 ligands or one or more other biomarkers is lower than the control level of expression, and (d) administering an anti-TLR4 antibody or immunologically active fragment thereof in an amount sufficient to alleviate the symptom of the disorder when the subject is identified as a responder. 2. The method of claim 1 , wherein the citrullinated protein is citrullinated fibrinogen, citrullinated fibrin, citrullinated vimentin, a citrullinated histone, citrullinated enolase or a citrullinated chemokine. 3. The method of claim 2 , wherein the citrullinated histone is citrullinated histone 2b. 4. The method of claim 2 , wherein the citrullinated chemokine is citrullinated CXCL10. 5. The method of claim 1 , wherein the citrullinated protein is in an immune complex. 6. The method of claim 5 , wherein the citrullinated protein in an immune complex is citrullinated fibrinogen (cFb) in an immune complex with an IgG protein (cFb-IC). 7. The method of claim 1 , wherein the biological sample is or is derived from blood. 8. The method of claim 1 , wherein the biological sample is or is derived from urine. 9. The method of claim 1 , wherein the biological sample is or is derived from synovial fluid. 10. The method of claim 1 , wherein the anti-TLR4 antibody or immunologically active fragment thereof comprises a variable heavy chain complementarity determining region 1 (VH CDR1) the amino acid sequence of GGYSWH (SEQ ID NO: 1); a VH CDR2 region comprising the amino acid sequence of YIHYSGYTDFNPSLKT (SEQ ID NO: 2); a VH CDR3 region comprising the amino acid sequence of KDPSDAFPY (SEQ ID NO: 3); a variable light chain complementarity determining region 1 (VL CDR1) region comprising the amino acid sequence of RASQSISDHLH (SEQ ID NO: 4); a VL CDR2 region comprising the amino acid sequence of YASHAIS (SEQ ID NO: 5); and a VL CDR3 region comprising the amino acid sequence of QQGHSFPLT (SEQ ID NO: 6). 11. The method of claim 10 , wherein the anti-TLR4 antibody or immunologically active fragment thereof comprises the heavy chain variable amino acid sequence QVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIRQPPGKGLEWMGYIHYSGYT DFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCARKDPSDAFPYWGQGTLVTVSS (SEQ ID NO: 7) and the light chain variable amino acid sequence EIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPDQSPKLLIKYASHAISGVPSR FSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGTKVEIK (SEQ ID NO: 8). 12. The method of claim 11 , wherein the anti-TLR4 antibody or immunologically active fragment thereof comprises the heavy chain amino acid sequence MGWSWIFLFLLSGTAGVHCQVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIRQ PPGKGLEWMGYIHYSGYTDFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCARK DPSDAFPYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSSKAFPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 9) and the light chain amino acid sequence MEWSWVFLFFLSVTTGVHSEIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPD QSPKLLIKYASHAISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGT KVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 10). 13. The method of claim 1 , wherein the subject is human. 14. The method of claim 1 , wherein the disorder is rheumatoid arthritis (RA). 15. The method of claim 1 , wherein the disorder is atherosclerosis. 16. The method of claim 1 , wherein the disorder is associated with organ or tissue transplantation. 17. The method of claim 1 , wherein the disorder is associated with acute lung injury. 18. The method of claim 1 , wherein the disorder is associated with ischemia/reperfusion injury.
for hyperglycaemia, e.g. antidiabetics · CPC title
Drugs for disorders of the cardiovascular system · CPC title
Antiallergic agents (antiasthmatic agents A61P11/06; ophthalmic antiallergics A61P27/14) · CPC title
Immunosuppressants, e.g. drugs for graft rejection · CPC title
Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.