Methods and compositions for diagnosis and treatment of disorders in patients with elevated levels of TLR4 ligands and other biomarkers

US9688769B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-9688769-B2
Application numberUS-201414520904-A
CountryUS
Kind codeB2
Filing dateOct 22, 2014
Priority dateOct 22, 2013
Publication dateJun 27, 2017
Grant dateJun 27, 2017

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

This invention relates generally to methods and compositions for diagnosing and treating disorders associated with elevated levels of Toll-like Receptor 4 (TLR4) ligands and other biomarkers. The invention also relates to methods of treating, delaying the progression of, or otherwise ameliorating a symptom of a disorder associated with elevated levels of TLR4 ligands and other biomarkers using agents that interfere with or otherwise antagonize TLR4 signaling, including neutralizing anti-TLR4 antibodies.

First claim

Opening claim text (preview).

What is claimed is: 1. A method of alleviating a symptom of a disorder associated with excessive aberrant TLR4 signaling or elevated TLR4 ligand expression or activity, wherein the disorder is an autoimmune or inflammatory disorder, the method comprising: (a) detecting a level of one or more TLR4 ligands or one or more other biomarkers selected from the group consisting of anti-citrullinated protein antibody (ACPA), a citrullinated fibrinogen (cFb) in an immune complex with an IgG protein (cFb-IC), HMGB1, S100A8/A9, Tenascin C, and combinations thereof in a biological sample from a subject, (b) comparing the detected level of the one or more TLR4 ligands or the one or more biomarkers to a control level of expression selected from the group consisting of: (i) a control level of expression for ACPA of 1000 μl/ml for monocyte response score or fibroblast response score in a synovial fluid sample or a control level of expression for ACPA of 330 μl/ml for combined monocyte and fibroblast response score (cMFRS), (ii) a control level of cFb-IC detected at OD 450 nm of 1.2 for monocyte response score or fibroblast response score in a synovial fluid sample or a control level of expression for cFb-IC detected at OD 450 nm of 0.55 for cMFRS, (iii) a control level of HMGB1 of 50 ng/ml for monocyte response score in a synovial fluid sample or a control level of HMGB1 of 45 ng/ml for cMFRS, (iv) a control level of S100A8/A9 of 387 ng/ml for monocyte response score or for cMFRS in a synovial fluid sample, (v) a control level of Tenascin C of 100 ng/ml for monocyte response score in a synovial fluid sample, (c) identifying the subject as a responder when the detected level of the one or more TLR4 ligands or one or more other biomarkers is greater than the control level of expression, or identifying the subject as a non-responder when the detected level of expression of the one or more TLR4 ligands or one or more other biomarkers is lower than the control level of expression, and (d) administering an anti-TLR4 antibody or immunologically active fragment thereof in an amount sufficient to alleviate the symptom of the disorder when the subject is identified as a responder. 2. The method of claim 1 , wherein the citrullinated protein is citrullinated fibrinogen, citrullinated fibrin, citrullinated vimentin, a citrullinated histone, citrullinated enolase or a citrullinated chemokine. 3. The method of claim 2 , wherein the citrullinated histone is citrullinated histone 2b. 4. The method of claim 2 , wherein the citrullinated chemokine is citrullinated CXCL10. 5. The method of claim 1 , wherein the citrullinated protein is in an immune complex. 6. The method of claim 5 , wherein the citrullinated protein in an immune complex is citrullinated fibrinogen (cFb) in an immune complex with an IgG protein (cFb-IC). 7. The method of claim 1 , wherein the biological sample is or is derived from blood. 8. The method of claim 1 , wherein the biological sample is or is derived from urine. 9. The method of claim 1 , wherein the biological sample is or is derived from synovial fluid. 10. The method of claim 1 , wherein the anti-TLR4 antibody or immunologically active fragment thereof comprises a variable heavy chain complementarity determining region 1 (VH CDR1) the amino acid sequence of GGYSWH (SEQ ID NO: 1); a VH CDR2 region comprising the amino acid sequence of YIHYSGYTDFNPSLKT (SEQ ID NO: 2); a VH CDR3 region comprising the amino acid sequence of KDPSDAFPY (SEQ ID NO: 3); a variable light chain complementarity determining region 1 (VL CDR1) region comprising the amino acid sequence of RASQSISDHLH (SEQ ID NO: 4); a VL CDR2 region comprising the amino acid sequence of YASHAIS (SEQ ID NO: 5); and a VL CDR3 region comprising the amino acid sequence of QQGHSFPLT (SEQ ID NO: 6). 11. The method of claim 10 , wherein the anti-TLR4 antibody or immunologically active fragment thereof comprises the heavy chain variable amino acid sequence QVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIRQPPGKGLEWMGYIHYSGYT DFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCARKDPSDAFPYWGQGTLVTVSS (SEQ ID NO: 7) and the light chain variable amino acid sequence EIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPDQSPKLLIKYASHAISGVPSR FSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGTKVEIK (SEQ ID NO: 8). 12. The method of claim 11 , wherein the anti-TLR4 antibody or immunologically active fragment thereof comprises the heavy chain amino acid sequence MGWSWIFLFLLSGTAGVHCQVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIRQ PPGKGLEWMGYIHYSGYTDFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCARK DPSDAFPYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSSKAFPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 9) and the light chain amino acid sequence MEWSWVFLFFLSVTTGVHSEIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPD QSPKLLIKYASHAISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGT KVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 10). 13. The method of claim 1 , wherein the subject is human. 14. The method of claim 1 , wherein the disorder is rheumatoid arthritis (RA). 15. The method of claim 1 , wherein the disorder is atherosclerosis. 16. The method of claim 1 , wherein the disorder is associated with organ or tissue transplantation. 17. The method of claim 1 , wherein the disorder is associated with acute lung injury. 18. The method of claim 1 , wherein the disorder is associated with ischemia/reperfusion injury.

Assignees

Inventors

Classifications

  • for hyperglycaemia, e.g. antidiabetics · CPC title

  • Drugs for disorders of the cardiovascular system · CPC title

  • Antiallergic agents (antiasthmatic agents A61P11/06; ophthalmic antiallergics A61P27/14) · CPC title

  • Immunosuppressants, e.g. drugs for graft rejection · CPC title

  • Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US9688769B2 cover?
This invention relates generally to methods and compositions for diagnosing and treating disorders associated with elevated levels of Toll-like Receptor 4 (TLR4) ligands and other biomarkers. The invention also relates to methods of treating, delaying the progression of, or otherwise ameliorating a symptom of a disorder associated with elevated levels of TLR4 ligands and other biomarkers using …
Who is the assignee on this patent?
Novimmune Sa
What technology area does this patent fall under?
Primary CPC classification C07K16/2896. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Jun 27 2017 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).