Methods and nucleic acid molecules for aav vector selection
US-2024417717-A1 · Dec 19, 2024 · US
US9688727B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-9688727-B2 |
| Application number | US-201414429803-A |
| Country | US |
| Kind code | B2 |
| Filing date | Sep 24, 2014 |
| Priority date | Sep 24, 2013 |
| Publication date | Jun 27, 2017 |
| Grant date | Jun 27, 2017 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
The present invention provides recombinant adenoviral compositions and methods for their use in treating disorders associated with epithelial tissues.
Opening claim text (preview).
We claim: 1. A recombinant AdB-2/3 fiber polypeptide, comprising: (a) one or more AdB-2/3 fiber polypeptide shaft domain motifs; (b) an AdB-2/3 fiber polypeptide knob domain operatively linked to and located C-terminal to the one or more AdB-2/3 fiber polypeptide shaft domain motifs, wherein the AdB-2/3 fiber polypeptide knob domain comprises the peptide of SEQ ID NO:4 TLWTGPKPEA NCIIEYGKQN PDSKLTLILV KNGG(I/L)VNGYV TLMGASDYVN TLFKNKNVSI NVELYFDATG HILPDSSSLK TDLEX2 X3YKQTAD X4 SARGFMP STTAYPFX5LP NAGTHNX6NX7 IFGQCYY X8 ASDGALFPLEVTV MLNKRLPDSR TSYVMTFLWS LX9AGLAPETT QATLITSPFT FSYIREDD (SEQ ID NO:4), wherein: X2 is H, L, or P; X3 is K or E; X4 is T, F, S, or L; X5 is V, or D; X6 is E or G; X7 is Y or F; X8 is T, K, or E; and X9 is N or S; and wherein at least one of the following is true: X2 is P; X3 is E; X4 is S, or L; X5 is D; X6 is G; X7 is F; X8 is E; or X9 is S; and (c) one or more non-AdB-2/3-derived dimerization domains operatively linked to and located N-terminal to the one or more AdB-2/3 fiber polypeptide shaft domain motifs. 2. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein the AdB-2/3 fiber polypeptide does not include an AdB-2/3 fiber polypeptide tail domain. 3. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein each shaft domain motif is selected from the group consisting of an Ad3 fiber polypeptide shaft domain motif, an Ad7 fiber polypeptide shaft domain motif, an Ad11 fiber polypeptide shaft domain motif, an Ad14 fiber polypeptide shaft domain motif, an Ad14a fiber polypeptide shaft domain motif, and combinations thereof. 4. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein the one or more shaft domain motifs comprise 1-22 shaft domain motifs. 5. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein each shaft domain motif comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 43-48. 6. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein the dimerization domain comprises an amino acid sequence selected from the group consisting of EVSALEK (SEQ ID NO:24) and/or KVSALKE (SEQ ID NO: 25). 7. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein the one or more shaft domain motifs are the shaft domain motif of SEQ ID NO:43. 8. The recombinant AdB-2/3 fiber polypeptide of claim 1 , comprising the amino acid sequence of (a) (SEQ ID NO: 28) (M/)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGG SGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVN GYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKY KQTADFSARGFMPSTTAYPFVLPNAGTHNENFIFGQCYYKASDGALFPLE VTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRED D; (b) (SEQ ID NO: 29) (M/)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGG SGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVN GYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELEY KQTADSSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPLE VTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRED D; (c) (SEQ ID NO: 30) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGG GSGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIV NGYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELK YKQTADFSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPL EVTVMLNKRLPDSRTSYVMTFLWSLSAGLAPETTQATLITSPFTFSYIRE DD; (d) (SEQ ID NO: 31) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGG GSGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIV NGYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELK YKQTADFSARGFMPSTTAYPFDLPNAGTHNENYIFGQCYYKASDGALFPL EVTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRE DD; (e) (SEQ ID NO: 32) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGG GSGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIL VNGYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLEP KYKQTADFSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYFASDGALFP LEVTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIR EDD; (F) (SEQ ID NO: 33) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGG GSGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIV NGYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELK YKQTADLSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPL EVTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRE DD; and/or (g) (SEQ ID NO: 34) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGG GSGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIV NGYVT
Related publications grouped by family.
Answers are generated from the same data shown on this page.