Desmoglein 2 (DSG2) binding proteins and uses therefor

US9688727B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-9688727-B2
Application numberUS-201414429803-A
CountryUS
Kind codeB2
Filing dateSep 24, 2014
Priority dateSep 24, 2013
Publication dateJun 27, 2017
Grant dateJun 27, 2017

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The present invention provides recombinant adenoviral compositions and methods for their use in treating disorders associated with epithelial tissues.

First claim

Opening claim text (preview).

We claim: 1. A recombinant AdB-2/3 fiber polypeptide, comprising: (a) one or more AdB-2/3 fiber polypeptide shaft domain motifs; (b) an AdB-2/3 fiber polypeptide knob domain operatively linked to and located C-terminal to the one or more AdB-2/3 fiber polypeptide shaft domain motifs, wherein the AdB-2/3 fiber polypeptide knob domain comprises the peptide of SEQ ID NO:4 TLWTGPKPEA NCIIEYGKQN PDSKLTLILV KNGG(I/L)VNGYV TLMGASDYVN TLFKNKNVSI NVELYFDATG HILPDSSSLK TDLEX2 X3YKQTAD X4 SARGFMP STTAYPFX5LP NAGTHNX6NX7 IFGQCYY X8 ASDGALFPLEVTV MLNKRLPDSR TSYVMTFLWS LX9AGLAPETT QATLITSPFT FSYIREDD (SEQ ID NO:4), wherein: X2 is H, L, or P; X3 is K or E; X4 is T, F, S, or L; X5 is V, or D; X6 is E or G; X7 is Y or F; X8 is T, K, or E; and X9 is N or S; and wherein at least one of the following is true: X2 is P; X3 is E; X4 is S, or L; X5 is D; X6 is G; X7 is F; X8 is E; or X9 is S; and (c) one or more non-AdB-2/3-derived dimerization domains operatively linked to and located N-terminal to the one or more AdB-2/3 fiber polypeptide shaft domain motifs. 2. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein the AdB-2/3 fiber polypeptide does not include an AdB-2/3 fiber polypeptide tail domain. 3. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein each shaft domain motif is selected from the group consisting of an Ad3 fiber polypeptide shaft domain motif, an Ad7 fiber polypeptide shaft domain motif, an Ad11 fiber polypeptide shaft domain motif, an Ad14 fiber polypeptide shaft domain motif, an Ad14a fiber polypeptide shaft domain motif, and combinations thereof. 4. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein the one or more shaft domain motifs comprise 1-22 shaft domain motifs. 5. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein each shaft domain motif comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 43-48. 6. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein the dimerization domain comprises an amino acid sequence selected from the group consisting of EVSALEK (SEQ ID NO:24) and/or KVSALKE (SEQ ID NO: 25). 7. The recombinant AdB-2/3 fiber polypeptide of claim 1 , wherein the one or more shaft domain motifs are the shaft domain motif of SEQ ID NO:43. 8. The recombinant AdB-2/3 fiber polypeptide of claim 1 , comprising the amino acid sequence of (a) (SEQ ID NO: 28) (M/)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGG SGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVN GYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKY KQTADFSARGFMPSTTAYPFVLPNAGTHNENFIFGQCYYKASDGALFPLE VTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRED D; (b) (SEQ ID NO: 29) (M/)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGG SGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVN GYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELEY KQTADSSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPLE VTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRED D; (c) (SEQ ID NO: 30) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGG GSGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIV NGYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELK YKQTADFSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPL EVTVMLNKRLPDSRTSYVMTFLWSLSAGLAPETTQATLITSPFTFSYIRE DD; (d) (SEQ ID NO: 31) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGG GSGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIV NGYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELK YKQTADFSARGFMPSTTAYPFDLPNAGTHNENYIFGQCYYKASDGALFPL EVTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRE DD; (e) (SEQ ID NO: 32) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGG GSGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIL VNGYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLEP KYKQTADFSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYFASDGALFP LEVTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIR EDD; (F) (SEQ ID NO: 33) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGG GSGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIV NGYVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELK YKQTADLSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPL EVTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRE DD;  and/or (g) (SEQ ID NO: 34) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGG GSGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIV NGYVT

Assignees

Inventors

Classifications

  • Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title

  • for hyperglycaemia, e.g. antidiabetics · CPC title

  • Antihypertensives · CPC title

  • Antineoplastic agents · CPC title

  • for tuberculosis · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US9688727B2 cover?
The present invention provides recombinant adenoviral compositions and methods for their use in treating disorders associated with epithelial tissues.
Who is the assignee on this patent?
Univ Washington Through Its Center For Commercialization, Univ Washington
What technology area does this patent fall under?
Primary CPC classification C07K14/005. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Jun 27 2017 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).