Methods and compositions for treating cancer and inflammatory diseases

Patent metadata

Field	Value
Publication number	US-9683025-B2
Application number	US-201414775643-A
Country	US
Kind code	B2
Filing date	Mar 13, 2014
Priority date	Mar 13, 2013
Publication date	Jun 20, 2017
Grant date	Jun 20, 2017

Abstract

The invention provides a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. The invention also provides related pharmaceutical composition comprising such a peptide construct. Also provided is a conjugate comprising such a peptide construct and a carrier molecule. The invention also provides related pharmaceutical compositions. Also provided are related methods of inhibiting cell proliferation in an individual and methods of treating cancer in by such pharmaceutical compositions. The present application also provides methods of treating an inflammatory disease and inhibiting inflammation in an individual comprising administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP.

First claim

The invention claimed is:

1. A method of treating psoriasis in an individual, the method comprising administering to the individual an effective amount of a peptide comprising the amino acid sequence of SEQ ID NO:23 (KETWWETWWTEWSQPKKKRKVLEEPGQPLDLSCKRPR).

2. A method of reducing inflammation in an individual suffering from psoriasis, the method comprising administering to the individual an effective amount of a peptide comprising the amino acid sequence of SEQ ID NO:23 (KETWWETWWTEWSQPKKKRKVLEEPGQPLDLSCKRPR).

3. The method of claim 1 , wherein the peptide is administered intravenously, subcutaneously, orally, or topically to the individual.

4. The method of claim 1 , wherein the peptide is formulated in a pharmaceutically acceptable composition.

5. The method of claim 2 , wherein the peptide is administered intravenously, subcutaneously, orally, or topically to the individual.

6. The method of claim 2 , wherein the peptide is formulated in a pharmaceutically acceptable composition.

Assignees

• Univ Colorado Regents

Inventors

• Zhang Qinghong
• Zhao Rui
• Wang Xiao-Jing
• Blevins Melanie

Classifications

• A61P35/00

  Antineoplastic agents · CPC title

• C07K14/4703 Primary

  Inhibitors; Suppressors · CPC title

• A61K38/00

  Medicinal preparations containing peptides (peptides containing beta-lactam rings A61K31/00; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, A61K31/00; ergot alkaloids of the cyclic peptide type A61K31/48; containing macromolecular compounds having statistically distributed amino acid units A61K31/74; medicinal preparations containing antigens or antibodies A61K39/00; medicinal preparations characterised by the non-active ingredients, e.g. peptides as drug carriers, A61K47/00) · CPC title

• C07K2319/10

  containing a tag for extracellular membrane crossing, e.g. TAT or VP22 · CPC title

• A61P29/00

  Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID] · CPC title