Biodegradable electroconducting nanowire, method of manufacture and uses thereof

Patent metadata

Field	Value
Publication number	US-9550810-B2
Application number	US-201214003560-A
Country	US
Kind code	B2
Filing date	Mar 6, 2012
Priority date	Mar 7, 2011
Publication date	Jan 24, 2017
Grant date	Jan 24, 2017

Abstract

The subject matter of the invention is an electroconducting nanowire, comprising an amyloid fiber which results from the self-assembling of peptides comprising a prion domain or a derivative of this domain and which is functionalized by electron transporting peptides, each comprising amino acids bound to one or more atoms of iron.
Its subject matter is also a method of manufacturing this nanowire as well as the uses of said nanowire.
Uses: manufacture of sensors for the detection of chemical or biological species, of nano-batteries, of radio-identification systems, of molecular memory systems, etc.

First claim

The invention claimed is:

1. An electroconducting nanowire, comprising an amyloid fibre which results from a self-assembling of first peptides comprising a prion domain or a derivative of the prion domain, the derivative being capable of forming amyloid fibres, each first peptide comprising the following sequence of amino acids:

(SEQ ID NO: 8)

KIDAIVGRNSAKDIRTEERARVQLGNVVTAAALHGGIRISDOTTNSVETV

VGKGERSRVLIGNEYGGKGFWDN,

or a sequence of amino acids having at least 75% identity with SEQ ID NO: 8, the amyloid fibre being linked by covalent bonds to second peptides, the second peptides being electron transporting peptides, each electron transporting peptide comprising amino acids bound to one or more atoms of iron and comprising a sequence of amino-acids of a protein with an iron-sulphur centre, or a sequence of amino-acids having at least 75% identity with the sequence of amino-acids of the protein with the iron-sulphur centre, the protein with the iron-sulphur centre being a rubredoxine, a ferredoxin or a hydrogenase.

2. The electroconducting nanowire of claim 1 , wherein each first peptide is linked by one covalent bond to a second peptide.

3. The electroconducting nanowire of claim 1 , wherein the protein with the iron-sulphur centre is a rubredoxin.

4. The electroconducting nanowire of claim 3 , wherein the rubredoxin is a rubredoxin of Methanococcus voltae.

5. The electroconducting nanowire of claim 4 , wherein each second peptide comprises the following sequence of amino acids:

(SEQ ID NO: 1)

MAIWQCTVCGYKYDEDKEKKKFEDLPADCKCPVCGAKKEMFKKL,

or a sequence of amino acids having at least 75% identity with SEQ ID NO: 1.

6. The electroconducting nanowire of claim 1 , wherein the first peptides comprise the following sequence of amino acids:

(SEQ ID NO: 13)

MEIDAIVGRNSAKDIRTEERARVQLGNVVTAAALHGGIRISDQTTNSVE

TVVGKGESRVLIGNEYGGKGFWDN.

7. The electroconducting nanowire of claim 1 , which is constituted of the amyloid fibre which results from the self-assembling of first peptides each having the following sequence of amino acids:

(SEQ ID NO: 13)

MEIDAIVGRNSAKDIRTEERARVQLGNVVTAAALHGGIRISDQTTNSVE

TVVGKGESRVLIGNEYGGKGFWDN,

each first peptide being linked by a covalent bond to a second peptide having the following sequence of amino acids:

(SEQ ID NO: 6)

MAIWQCTVCGYKYDEDKEKKKFEDLPADYKCPVCGAKKEMFKKS.

Assignees

• Forge Vincent
• Horvath Christophe
• Fontecave Marc
• Duraffourg Nicolas
• Commissariat Energie Atomique

Inventors

• Forge Vincent
• Horvath Christophe
• Fontecave Marc
• Duraffourg Nicolas

Classifications

• C07K2319/735

  containing a domain for self-assembly, e.g. a viral coat protein (includes phage display) · CPC title

• C07K14/001 Primary

  by chemical synthesis · CPC title

• C07K14/4711

  Alzheimer's disease; Amyloid plaque core protein · CPC title

• B82Y40/00

  Manufacture or treatment of nanostructures · CPC title

• B82Y30/00 Primary

  Nanotechnology for materials or surface science, e.g. nanocomposites · CPC title