Tissue-directed antibodies and methods of using the same
US-2024342260-A1 · Oct 17, 2024 · US
US9512221B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-9512221-B2 |
| Application number | US-201414278583-A |
| Country | US |
| Kind code | B2 |
| Filing date | May 15, 2014 |
| Priority date | Jan 10, 2011 |
| Publication date | Dec 6, 2016 |
| Grant date | Dec 6, 2016 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
This invention relates generally to antibodies that specifically bind Toll-like Receptor 4 (TLR-4), and to methods of using the anti-TLR4 antibodies as therapeutics and to methods of using the anti-TLR4 antibodies in methods of preventing transplant rejection and/or prolonging survival of transplanted biological material.
Opening claim text (preview).
What is claimed is: 1. A method of inhibiting rejection of or prolonging survival of transplanted biological material in a subject, the method comprising: (i) contacting the biological material to be transplanted with an antibody or antigen binding fragment thereof that specifically binds a human Toll-like receptor 4 (TLR4) polypeptide to produce a transplantable composition, and (ii) implanting the transplantable composition at a desired location in the subject, wherein the antibody or antigen binding fragment thereof is administered in an amount sufficient to prolong survival of the transplanted biological material in the subject, and wherein the antibody or antigen binding fragment thereof comprises the heavy chain amino acid sequence MGWSWIFLFLLSGTAGVHCQVQLQESGPGLVKPSDTLSLTCAVSG YSITGGYSWHWIRQPPGKGLEWMGYIHYSGYTDFNPSLKTRITISRDTSKNQFSLKLSSV TAVDTAVYYCARKDPSDAFPYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH KPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSSKAFPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK (SEQ ID NO: 9) and the light chain amino acid sequence MEWSWVFLFFLSVTT GVHSEIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPDQSPKLLIKYASHAISG VPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGTKVEIKRTVAAPSVFIF PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 10), thereby inhibiting rejection of or prolonging survival of transplanted biological material in the subject. 2. The method of claim 1 , wherein the subject is a human. 3. The method of claim 1 , wherein the biological material to be transplanted is selected from the group consisting of one or more cells or cell types, one or more tissues or tissue types, an organ or portion thereof, allogeneic biological material, islet cells, allogeneic islet cells, biological material that is or is derived from kidney, biological material that is or is derived from pancreas, biological material that is or is derived from liver, and biological material that is or is derived from intestine. 4. The method of claim 1 , wherein the antibody or antigen binding fragment thereof that specifically binds TLR4 is administered in combination with one or more additional agents. 5. The method of claim 4 , wherein the one or more additional agents is one or more immunosuppressive agents. 6. The method of claim 4 , wherein the one or more additional agents is selected from methotrexate, cyclosporin A, tacrolimus, sirolimus, everolimus, a corticosteroid, anti-thymocyte globulin, Infliximab, Etanercept and Adalimumab.
Immunosuppressants, e.g. drugs for graft rejection · CPC title
Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title
Blood; Artificial blood (perfluorocarbons A61K31/02; umbilical cord blood A61K35/51; haemoglobin A61K38/42) · CPC title
Pancreas; Islets of Langerhans (Langerhans cells of epidermis A61K35/36) · CPC title
Animal cells · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.