Anti-TLR4 antibodies and methods of use thereof

US9512221B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-9512221-B2
Application numberUS-201414278583-A
CountryUS
Kind codeB2
Filing dateMay 15, 2014
Priority dateJan 10, 2011
Publication dateDec 6, 2016
Grant dateDec 6, 2016

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

This invention relates generally to antibodies that specifically bind Toll-like Receptor 4 (TLR-4), and to methods of using the anti-TLR4 antibodies as therapeutics and to methods of using the anti-TLR4 antibodies in methods of preventing transplant rejection and/or prolonging survival of transplanted biological material.

First claim

Opening claim text (preview).

What is claimed is: 1. A method of inhibiting rejection of or prolonging survival of transplanted biological material in a subject, the method comprising: (i) contacting the biological material to be transplanted with an antibody or antigen binding fragment thereof that specifically binds a human Toll-like receptor 4 (TLR4) polypeptide to produce a transplantable composition, and (ii) implanting the transplantable composition at a desired location in the subject, wherein the antibody or antigen binding fragment thereof is administered in an amount sufficient to prolong survival of the transplanted biological material in the subject, and wherein the antibody or antigen binding fragment thereof comprises the heavy chain amino acid sequence MGWSWIFLFLLSGTAGVHCQVQLQESGPGLVKPSDTLSLTCAVSG YSITGGYSWHWIRQPPGKGLEWMGYIHYSGYTDFNPSLKTRITISRDTSKNQFSLKLSSV TAVDTAVYYCARKDPSDAFPYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH KPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSSKAFPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK (SEQ ID NO: 9) and the light chain amino acid sequence MEWSWVFLFFLSVTT GVHSEIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPDQSPKLLIKYASHAISG VPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGTKVEIKRTVAAPSVFIF PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 10), thereby inhibiting rejection of or prolonging survival of transplanted biological material in the subject. 2. The method of claim 1 , wherein the subject is a human. 3. The method of claim 1 , wherein the biological material to be transplanted is selected from the group consisting of one or more cells or cell types, one or more tissues or tissue types, an organ or portion thereof, allogeneic biological material, islet cells, allogeneic islet cells, biological material that is or is derived from kidney, biological material that is or is derived from pancreas, biological material that is or is derived from liver, and biological material that is or is derived from intestine. 4. The method of claim 1 , wherein the antibody or antigen binding fragment thereof that specifically binds TLR4 is administered in combination with one or more additional agents. 5. The method of claim 4 , wherein the one or more additional agents is one or more immunosuppressive agents. 6. The method of claim 4 , wherein the one or more additional agents is selected from methotrexate, cyclosporin A, tacrolimus, sirolimus, everolimus, a corticosteroid, anti-thymocyte globulin, Infliximab, Etanercept and Adalimumab.

Assignees

Inventors

Classifications

  • Immunosuppressants, e.g. drugs for graft rejection · CPC title

  • Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title

  • Blood; Artificial blood (perfluorocarbons A61K31/02; umbilical cord blood A61K35/51; haemoglobin A61K38/42) · CPC title

  • Pancreas; Islets of Langerhans (Langerhans cells of epidermis A61K35/36) · CPC title

  • Animal cells · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US9512221B2 cover?
This invention relates generally to antibodies that specifically bind Toll-like Receptor 4 (TLR-4), and to methods of using the anti-TLR4 antibodies as therapeutics and to methods of using the anti-TLR4 antibodies in methods of preventing transplant rejection and/or prolonging survival of transplanted biological material.
Who is the assignee on this patent?
Novimmune Sa
What technology area does this patent fall under?
Primary CPC classification C07K16/2896. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Dec 06 2016 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).