Humanized monoclonal antibodies and methods of use

US9416169B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-9416169-B2
Application numberUS-201514597044-A
CountryUS
Kind codeB2
Filing dateJan 14, 2015
Priority dateDec 28, 2007
Publication dateAug 16, 2016
Grant dateAug 16, 2016

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The present invention comprises a humanized monoclonal antibody that binds to the chemokine receptor CCR4. This antibody is derived from Mab 1567 and recognizes the same epitope. Binding of the invented antibody to CCR4 inhibits ligand-mediated activities and is used to treat symptoms of cancer. Moreover, the antibody is used in combination with vaccines to suppress the activity of regulatory T cells.

First claim

Opening claim text (preview).

What is claimed is: 1. A method of selectively killing a tumor cell comprising contacting said cell with a composition comprising a humanized monoclonal CC-chemokine receptor 4 (CCR4) antibody or fragment thereof, wherein said antibody has the following characteristics: a. binds to CCR4 positive (CCR4+) cells but not CCR4 negative (CCR4−) cells; b. decreases binding of a ligand or agonist to the CCR4 receptor; and wherein said antibody comprises i. a heavy chain variable region encoded by the nucleic acid sequence comprising: CAGGTGCAGCTGGTGCAGAGCGGAGCCGAGGTGAAGAAGCCTG GAGCTTCCGTCAAGGTGTCCTGCAAGGCCAGCGGCTACACCTTC GCCAGCTACTACATGCACTGGATGCGGCAGGCACCTGGACAGG GCCTCGAATGGATCGGCTGGATCAACCCCGGCAACGTGAACAC CAAGTACAACGAGAAGTTCAAGGGCAGGGCCACCCTGACCGTG GACACCAGCACCAACACCGCCTACATGGAACTGAGCAGCCTGC GGAGCGAGGACACCGCCGTGTACTACTGCGCCAGAAGCACCTA CTACCGGCCCCTGGACTACTGGGGCCAGGGCACCCTGGTGACC GTGAGCAGC (SEQ ID NO:1); or ii. a heavy chain variable region comprising the amino acid sequence: QVQLVQSGAEVKKPGASVKVSCKASGYTFASYYMHWMRQAPG QGLEWIGWINPGNVNTKYNEKFKGRATLTVDTSTNTAYMELS SL RSEDTAVYYCARS TYYRPLDYWGQGTLVTVSS (SEQ ID NO:2); and iii. a light chain variable region encoded by the nucleic acid sequence comprising: GACATCGTGATGACCCAGAGCCCCGACAGCCTGGCCGTGAGCC TGGGCGAGCGGGCCACCATCAACTGCAAGAGCAGCCAGAGCA TCCTGTACAGCAGCAACCAGAAGAACTACCTGGCCTGGTATCA GCAGAAGCCCGGCCAGAGCCCCAAGCTGCTGATCTACTGGGCC AGCACCCGGGAGAGCGGCGTGCCCGACCGGTTTAGCGGCAGC GGCTCCGGCACCGACTTCACCCTGACCATCAGCAGCCTGCAGG CCGAGGACGTGGCCGTGTACTACTGCCACCAGTACCTGAGCAG CTACACCTTCGGCCAGGGCACAAAGCTGGAAATCAAG (SEQID NO:3); or iv. a light chain variable region comprising the amino acid sequence: DIVMTQSPDSLAVSLGERATINCKSSQSILYSSNQKNYLAWYQQKPG QSPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC HQYLSSYTFGQGTKLEIK (SEQ ID NO:4). 2. The method of claim 1 , wherein said selective killing occurs by antibody-dependent cellular toxicity (ADCC), complement-dependent cytotoxicity (CDC), antibody dependent cellular phagocytosis (ADCP). 3. The method of claim 1 , wherein said tumor cell expresses CCR4. 4. The method of claim 1 , wherein said tumor cell is a T-cell. 5. A method of decreasing suppressor T-cell activity comprising contacting said cell with a composition comprising a humanized monoclonal CC-chemokine receptor 4 (CCR4) antibody or fragment thereof, wherein said antibody has the following characteristics: a. binds to CCR4 positive (CCR4+) cells but not CCR4 negative (CCR4−) cells; b. decreases binding of a ligand or agonist to the CCR4 receptor; and wherein said antibody comprises i. a heavy chain variable region encoded by the nucleic acid sequence comprising: CAGGTGCAGCTGGTGCAGAGCGGAGCCGAGGTGAAGAAGCCTG GAGCTTCCGTCAAGGTGTCCTGCAAGGCCAGCGGCTACACCTTC GCCAGCTACTACATGCACTGGATGCGGCAGGCACCTGGACAGG GCCTCGAATGGATCGGCTGGATCAACCCCGGCAACGTGAACAC CAAGTACAACGAGAAGTTCAAGGGCAGGGCCACCCTGACCGTG GACACCAGCACCAACACCGCCTACATGGAACTGAGCAGCCTGC GGAGCGAGGACACCGCCGTGTACTACTGCGCCAGAAGCACCTA CTACCGGCCCCTGGACTACTGGGGCCAGGGCACCCTGGTGACC GTGAGCAGC (SEQ ID NO:1); or ii. a heavy chain variable region comprising the amino acid sequence: QVQLVQSGAEVKKPGASVKVSCKASGYTFASYYMHWMRQAPG QGLEWIGWINPGNVNTKYNEKFKGRATLTVDTSTNTAYMELS SL RSEDTAVYYCARS TYYRPLDYWGQGTLVTVSS (SEQ ID NO:2); and iii. a light chain variable region encoded by the nucleic acid sequence comprising: GACATCGTGATGACCCAGAGCCCCGACAGCCTGGCCGTGAGCC TGGGCGAGCGGGCCACCATCAACTGCAAGAGCAGCCAGAGCA TCCTGTACAGCAGCAACCAGAAGAACTACCTGGCCTGGTATCA GCAGAAGCCCGGCCAGAGCCCCAAGCTGCTGATCTACTGGGCC AGCACCCGGGAGAGCGGCGTGCCCGACCGGTTTAGCGGCAGC GGCTCCGGCACCGACTTCACCCTGACCATCAGCAGCCTGCAGG CCGAGGACGTGGCCGTGTACTACTGCCACCAGTACCTGAGCAG CTACACCTTCGGCCAGGGCACAAAGCTGGAAATCAAG (SEQID NO:3); or iv. a light chain variable region comprising the amino acid sequence: DIVMTQSPDSLAVSLGERATINCKSSQSILYSSNQKNYLAWYQQKPG QSPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC HQYLSSYTFGQGTKLEIK (SEQ ID NO:4). 6. A method of augmenting an immune response to an antigen comprising contacting said cell with a composition comprising a humanized monoclonal CC-chemokine receptor 4 (CCR4) antibody or fragment thereof, wherein said antibody has the following characteristics: a. binds to CCR4 positive (CCR4+) cells but not CCR4 negative (CCR4−) cells; b. decreases binding of a ligand or agonist to the CCR4 receptor; and wherein said antibody comprises i. a heavy chain variable region encoded by the nucleic acid sequence comprising: CAGGTGCAGCTGGTGCAGAGCGGAGCCGAGGTGAAGAAGCCTG GAGCTTCCGTCAAGGTGTCCTGCAAGGCCAGCGGCTACACCTTC GCCAGCTACTACATGCACTGGATGCGGCAGGCACCTGGACAGG GCCTCGAATGGATCGGCTGGATCAACCCCGGCAACGTGAACAC CAAGTACAACGAGAAGTTCAAGGGCAGGGCCACCCTGACCGTG GACACCAGCACCAACACCGCCTACATGGAACTGAGCAGCCTGC GGAGCGAGGACACCGCCGTGTACTACTGCGCCAGAAGCACCTA CTACCGGCCCCTGGACTACTGGGGCCAGGGCACCCTGGTGACC GTGAGCAGC (SEQ ID NO:1); or ii. a heavy chain variable region comprising the amino acid sequence: QVQLVQSGAEVKKPGASVKVSCKASGYTFASYYMHWMRQAPG QGLEWIGWINPGNVNTKYNEKFKGRATLTVDTSTNTAYMELS SL RSEDTAVYYCARS TYYRPLDYWGQGTLVTVSS (SEQ ID NO:2); and iii. a light chain variable region encoded by the nucleic acid sequence comprising: GACATCGTGATGACCCAGAGCCCCGACAGCCTGGCCGTGAGCC TGGGCGAGCGGGCCACCATCAACTGCAAGAGCAGCCAGAGCA TCCTGTACAGCAGCAACCAGAAGAACTACCTGGCCTGGTATCA GCAGAAGCCCGGCCAGAGCCCCAAGCTGCTGATCTACTGGGCC AGCACCCGGGAGAGCGGCGTGCCCGACCGGTTTAGCGGCAGC GGCTCCGGCACCGACTTCACCCTGACCATCAGCAGCCTGCAGG CCGAGGACGTGGCCGTGTACTACTGCCACCAGTACCTGAGCAG CTACACCTTCGGCCAGGGCACAAAGCTGGAAATCAAG (SEQID NO:3); or iv. a light chain variable region comprising the amino acid sequence: DIVMTQSPDSLAVSLGERATINCKSSQSILYSSNQKNYLAWYQQKPG QSPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC HQYLSSYTFGQGTKLEIK (SEQ ID NO:4). 7. The method of claim 6 , wherein said antigen is a viral antigen, a bacterial antigen or a tumor associated antigen. 8. The method of claim 7 , wherein said viral antigen is HIV. 9. The method of claim 6 , wherein said antibody is administered prior to or after exposure to the antigen. 10. The method of claim 6 , wherein said administration of said antibody causes an increase in antigen specific T cell activity. 11. The method of claim 10 , wherein said T-cell is an effector T-cell. 12. A method of increasing vaccine efficiency comprising administering to a subject a vaccine and a composition comprising a humanized monoclonal CC-chemokine receptor 4 (CCR4) antibody or fragment thereof, wherein said antibody has the following characteristics: a. binds to CCR4 positive (CCR4+) cells but not CCR4 negative (CCR4−) cells; b. decreases binding of a ligand or agonist to the CCR4 receptor; and wherein said antibody comprises i. a heavy chain variable region encoded by the nucleic acid sequence comprising: CAGGTGCAGCTGGTGCAGAGCGGAGCCGAGGTGAAGAAGCCTG GAGCTTCCGTCAAGGTGTCCTGCAAGGCCAGCGGCTACACCTTC GCCAGCTACTACATGCACTGGATGCGGCAGGCACCTGGACAGG GCCTCGAATGGATCGGCTGGATCAACCCCGGCAACGTGAACAC CAAGTACAACGAGAAGTTCAAGGGCAGGGCCACCCTGACCGTG GACACCAGCACCAACACCGCCTACATGGAACTGAGCAGCCTGC GGAGCGAGGACACCGCCGTGTACTACTGCGCCAGAAGCACCTA CTACCGGCCCCTGGACTACTGGGGCCAGGGCACCCTGGTGACC GTGAGCAGC (SEQ ID NO:1); or ii. a heavy chain variable region comprising the amino acid sequence: QVQLVQSGAEVKKPGASVKVSCKASGYTFASYYMHWMRQAPG QGLEWIGWINPGNVNTKYNEKFKGRATLTVDTSTNTAYMELS SL RSEDTAVYYCARS TYYRPLDYWGQGTLVTVSS (SEQ ID NO:2); and iii. a light chain variable region encoded by the nucleic acid sequence comprising: GACATCGTGATGACCCAGAGCCCCGACAGCCTGGCCGTGAGCC TGGGCGAGCGGGCCACCATCAACTGCAAGAGCAGCCAGAGCA TCCTGTACAGCAGCAACCAGAAGAACTACCTGGCCTGGTATCA GCAGAAGCCCGGCCAGAGCCCCAAGCTGCTGATCTACTGGGCC AGCACCCGGGAGAGCGGCGTGCCCGACCGGTTTAGCGGCAGC GGCTCCGGCACCGACTTCACCCTGACCATCAGCAGCCTGCAGG CCGAGGACGTGGCCGTGTACTACTGCCACCAGTACCTGAGCAG CTACACCTTCGGCCAGGGCACAAAGCTGGAAATCAAG (SEQID NO:3

Assignees

Inventors

Classifications

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US9416169B2 cover?
The present invention comprises a humanized monoclonal antibody that binds to the chemokine receptor CCR4. This antibody is derived from Mab 1567 and recognizes the same epitope. Binding of the invented antibody to CCR4 inhibits ligand-mediated activities and is used to treat symptoms of cancer. Moreover, the antibody is used in combination with vaccines to suppress the activity of regulatory T…
Who is the assignee on this patent?
Dana Farber Cancer Inst Inc, The Brigham And Women'S Hospital
What technology area does this patent fall under?
Primary CPC classification C07K16/2866. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Aug 16 2016 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).