Dual-targeted therapeutic peptide for nasopharyngeal carcinoma, nanoparticles carrying same and uses thereof

Patent metadata

Field	Value
Publication number	US-9371364-B2
Application number	US-201314406399-A
Country	US
Kind code	B2
Filing date	Jun 7, 2013
Priority date	Jun 7, 2012
Publication date	Jun 21, 2016
Grant date	Jun 21, 2016

Abstract

Disclosed is a dual-targeted therapeutic peptide for nasopharyngeal carcinoma formed by covalently linking a targeted therapeutic peptide for nasopharyngeal carcinoma, a peptide linker and a targeted therapeutic peptide with an α-helical structure for nasopharyngeal carcinoma. Also disclosed is a nanoparticle containing the peptide. The peptide and the nanoparticle can be used to treat nasopharyngeal carcinoma.

First claim

What is claimed:

1. A peptide for nasopharyngeal carcinoma, wherein the peptide for nasopharyngeal carcinoma is formed by covalently linking FAEKFKEAVKDYFAKFWD (SEQ ID NO:2), a peptide linker and LTVSPWYLTVSPWY (SEQ ID NO:3) in sequence.

2. The peptide for nasopharyngeal carcinoma according to claim 1 , wherein the amino acid sequence of the peptide for nasopharyngeal carcinoma is:

(SEQ ID NO: 1)

FAEKFKEAVKDYFAKFWDGSGLTVSPWYLTVSPWY.

3. A nanoparticle for nasopharyngeal carcinoma consisting of:
a peptide for nasopharyngeal carcinoma formed by covalently linking FAEKFKEAVKDYFAKFWD (SEQ ID NO:2), a peptide linker and LTVSPWYLTVSPWY (SEQ ID NO:3) in sequence;
a phospholipid;
a cholesteryl ester; and
a cargo.

4. The nanoparticle for nasopharyngeal carcinoma according to claim 3 , wherein the cargo is an imaging contrast agent, a drug, or combinations thereof.

5. The nanoparticle for nasopharyngeal carcinoma according to claim 4 , wherein the imaging contrast agent is a fluorescent dye modified with cholesteryl ester.

6. The nanoparticle for nasopharyngeal carcinoma according to claim 5 , wherein the fluorescent dye is DiR-BOA or Fluo-BOA.

7. The nanoparticle for nasopharyngeal carcinoma according to claim 4 , wherein the drug is paclitaxel or curcumin.

8. The nanoparticle for nasopharyngeal carcinoma according to claim 3 , wherein the phospholipid is DMPC (1 ,2-dimyri stoyl-sn-glycero-3 -phosphocholine).

9. A method for diagnosis or treatment of nasopharyngeal carcinoma, comprising,
administering to a subject in need thereof a nanoparticle for nasopharyngeal carcinoma consisting of:
a peptide for nasopharyngeal carcinoma formed by covalently linking FAEKFKEAVKDYFAKFWD (SEQ ID NO:2), a peptide linker and LTVSPWYLTVSPWY (SEQ ID NO:3) in sequence;
a phospholipid:
a cholesteryl ester; and
a cargo.

Assignees

• Univ Huazhong Science Tech

Inventors

• Luo Qingming
• Zhang Zhihong
• Luo Haiming

Classifications

• A61P35/00

  Antineoplastic agents · CPC title

• A61K47/65

  Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers · CPC title

• C07K14/4747

  Apoptosis related proteins · CPC title

• A61K31/337

  having four-membered rings, e.g. taxol · CPC title

• C07K2319/33

  fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies · CPC title