Anti-VEGF antibodies

US9353177B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-9353177-B2
Application numberUS-201514636782-A
CountryUS
Kind codeB2
Filing dateMar 3, 2015
Priority dateAug 1, 2003
Publication dateMay 31, 2016
Grant dateMay 31, 2016

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

Anti-VEGF antibodies and variants thereof, including those having high affinity for binding to VEGF, are disclosed. Also provided are methods of using phage display technology with naïve libraries to generate and select the anti-VEGF antibodies with desired binding and other biological activities. Further contemplated are uses of the antibodies in research, diagnostic and therapeutic applications.

First claim

Opening claim text (preview).

The invention claimed is: 1. A method of inhibiting angiogenesis in a human, the method comprising administering to the human an antibody capable of binding to human VEGF, wherein the antibody comprises the following complementarity determining regions (CDRs): (a) a CDR-H1 comprising the amino acid sequence GFSISSSSIH (SEQ ID NO: 859); (b) a CDR-H2 comprising the amino acid sequence YISPSSGSTSYADSVKG (SEQ ID NO: 860); (c) a CDR-H3 comprising the amino acid sequence YYSSSYYYSYYYAMDY (SEQ ID NO: 861); (d) a CDR-L1 comprising the amino acid sequence RASQSYAYAVA (SEQ ID NO: 493); (e) a CDR-L2 comprising the amino acid sequence DASYLYS (SEQ ID NO: 494); and (f) a CDR-L3 comprising the amino acid sequence QQSYYSPYT (SEQ ID NO: 561). 2. The method of claim 1 , wherein the human is suffering from cancer or a disease caused by ocular neovascularization. 3. The method of claim 2 , wherein the cancer is selected from the group consisting of breast cancer, colorectal cancer, non-small cell lung cancer, non-Hodgkin's lymphoma (NHL), renal cancer, prostate cancer, liver cancer, head and neck cancer, melanoma, ovarian cancer, mesothelioma, and glioblastoma. 4. The method of claim 2 , wherein the disease caused by ocular neovascularization is diabetic blindness, retinopathy, primary diabetic retinopathy or age-induced macular degeneration. 5. A method of alleviating cancer or a disease caused by ocular neovascularization in a human, the method comprising administering to the human an antibody capable of binding to human VEGF, wherein the antibody comprises the following complementarity determining regions (CDRs): (a) a CDR-H1 comprising the amino acid sequence GFSISSSSIH (SEQ ID NO: 859); (b) a CDR-H2 comprising the amino acid sequence YISPSSGSTSYADSVKG (SEQ ID NO: 860); (c) a CDR-H3 comprising the amino acid sequence YYSSSYYYSYYYAMDY (SEQ ID NO: 861); (d) a CDR-L1 comprising the amino acid sequence RASQSYAYAVA (SEQ ID NO: 493); (e) a CDR-L2 comprising the amino acid sequence DASYLYS (SEQ ID NO: 494); and (f) a CDR-L3 comprising the amino acid sequence QQSYYSPYT (SEQ ID NO: 561). 6. The method of claim 5 , wherein the cancer is selected from the group consisting of breast cancer, colorectal cancer, non-small cell lung cancer, non-Hodgkin's lymphoma (NHL), renal cancer, prostate cancer, liver cancer, head and neck cancer, melanoma, ovarian cancer, mesothelioma, and glioblastoma. 7. The method of claim 5 , wherein the disease caused by ocular neovascularization is diabetic blindness, retinopathy, primary diabetic retinopathy, or age-induced macular degeneration. 8. The method of claim 5 , wherein the heavy chain of the antibody comprises the sequence EVQLVESGGGLVQPGGSLRLSCAASGFSISSSSIHWVRQAPGKGLEWVAYISPSSGSTSYADSVKGRFTISA DTSKNTAYLQMNSLRAEDTAVYYCSRYYSSSYYYSYYYAMDYWGQGTL (SEQ ID NO: 942). 9. The method of claim 5 , wherein the light chain of the antibody comprises the sequence DIQMTQSPSSLSASVGDRVTITCRASQSYAYAVAWYQQKPGKAPKLLIYDASYLYSGVPSRFSGSGSGTDFT LTISSLQPEDFATYYCQQSYYSPYTFGQGTKV (SEQ ID NO: 943). 10. The method of claim 5 , wherein the antibody is selected from the group consisting of a synthetic antibody, a chimeric antibody, a humanized antibody, and an affinity matured antibody. 11. The method of claim 5 , wherein the antibody is an antigen-binding antibody fragment. 12. The method of claim 5 , wherein the antibody is capable of binding human VEGF with a Kd value of no more than about 60 nM. 13. The method of claim 1 , wherein the heavy chain of the antibody comprises the sequence EVQLVESGGGLVQPGGSLRLSCAASGFSISSSSIHWVRQAPGKGLEWVAYISPSSGSTSYADSVKGRFTISA DTSKNTAYLQMNSLRAEDTAVYYCSRYYSSSYYYSYYYAMDYWGQGTL (SEQ ID NO: 942). 14. The method of claim 1 , wherein the light chain of the antibody comprises the sequence DIQMTQSPSSLSASVGDRVTITCRASQSYAYAVAWYQQKPGKAPKLLIYDASYLYSGVPSRFSGSGSGTDFT LTISSLQPEDFATYYCQQSYYSPYTFGQGTKV (SEQ ID NO: 943). 15. The method of claim 1 , wherein the antibody is selected from the group consisting of a synthetic antibody, a chimeric antibody, a humanized antibody, and an affinity matured antibody. 16. The method of claim 1 , wherein the antibody is an antigen-binding antibody fragment. 17. The method of claim 1 , wherein the antibody is capable of binding human VEGF with a Kd value of no more than about 60 nM. 18. A method of inhibiting angiogenesis in a human, the method comprising administering to the human a bispecific antibody capable of binding to human VEGF, wherein the bispecific antibody comprises the following complementarity determining regions (CDRs): (a) a CDR-H1 comprising the amino acid sequence GFSISSSSIH (SEQ ID NO: 859); (b) a CDR-H2 comprising the amino acid sequence YISPSSGSTSYADSVKG (SEQ ID NO: 860); (c) a CDR-H3 comprising the amino acid sequence YYSSSYYYSYYYAMDY (SEQ ID NO: 861); (d) a CDR-L1 comprising the amino acid sequence RASQSYAYAVA (SEQ ID NO: 493); (e) a CDR-L2 comprising the amino acid sequence DASYLYS (SEQ ID NO: 494); and (f) a CDR-L3 comprising the amino acid sequence QQSYYSPYT (SEQ ID NO: 561). 19. A method of alleviating cancer or a disease caused by ocular neovascularization in a human, the method comprising administering to the human a bispecific antibody capable of binding to human VEGF, wherein the bispecific antibody comprises the following complementarity determining regions (CDRs): (a) a CDR-H1 comprising the amino acid sequence GFSISSSSIH (SEQ ID NO: 859); (b) a CDR-H2 comprising the amino acid sequence YISPSSGSTSYADSVKG (SEQ ID NO: 860); (c) a CDR-H3 comprising the amino acid sequence YYSSSYYYSYYYAMDY (SEQ ID NO: 861); (d) a CDR-L1 comprising the amino acid sequence RASQSYAYAVA (SEQ ID NO: 493); (e) a CDR-L2 comprising the amino acid sequence DASYLYS (SEQ ID NO: 494); and (f) a CDR-L3 comprising the amino acid sequence QQSYYSPYT (SEQ ID NO: 561).

Assignees

Inventors

Classifications

  • Immunomodulators · CPC title

  • Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title

  • for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis · CPC title

  • Immunosuppressants, e.g. drugs for graft rejection · CPC title

  • Antibacterial agents · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US9353177B2 cover?
Anti-VEGF antibodies and variants thereof, including those having high affinity for binding to VEGF, are disclosed. Also provided are methods of using phage display technology with naïve libraries to generate and select the anti-VEGF antibodies with desired binding and other biological activities. Further contemplated are uses of the antibodies in research, diagnostic and therapeutic applications.
Who is the assignee on this patent?
Genentech Inc
What technology area does this patent fall under?
Primary CPC classification C07K16/22. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue May 31 2016 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).