Compositions and methods for targeted delivery to cells
US-2024390271-A1 · Nov 28, 2024 · US
Cell-penetrating peptides and uses thereof
US9303076B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-9303076-B2 |
| Application number | US-201514706645-A |
| Country | US |
| Kind code | B2 |
| Filing date | May 7, 2015 |
| Priority date | Jun 14, 2010 |
| Publication date | Apr 5, 2016 |
| Grant date | Apr 5, 2016 |
How to read this patent
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
- Title
What the patent document calls the invention.
- Abstract
A short plain-language summary of the technical disclosure.
- Assignees and inventors
Who owns or filed the patent and who is credited as inventor.
- Key dates
Filing, priority, publication, and grant dates set the timeline.
- First independent claim
The legal scope of protection — read this for what is actually claimed.
- CPC / IPC classifications
Technology tags used to group this patent with similar filings.
- Citations and related patents
Prior art links and similar publications in this corpus.
Abstract
Official abstract text for this publication.
The present invention relates to the identification and functional characterization of human cell-penetrating peptides (CPPs) and their use; in particular as transfection vehicles.
First claim
Opening claim text (preview).
The invention claimed is: 1. Composition comprising at least one peptide being attached to one or more nucleic acid molecules, the peptide being capable to be internalized into a cell, wherein the peptide: (a) has an amino acid sequence selected from the group consisting of: GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4); and an amino acid sequence having over its total length at le…
Assignees
Inventors
Classifications
Human Necessities · mapped topic
Human Necessities · mapped topic
Chemistry & Metallurgy · mapped topic
- C07K14/47Primary
Chemistry & Metallurgy · mapped topic
Chemistry & Metallurgy · mapped topic
Patent family
Related publications grouped by family.
External sources
Next steps
Free tools are coming soon. Tell us what you want to track and we'll notify you.
Frequently asked questions
Answers are generated from the same data shown on this page.
- What does patent US9303076B2 cover?
- The present invention relates to the identification and functional characterization of human cell-penetrating peptides (CPPs) and their use; in particular as transfection vehicles.
- Who is the assignee on this patent?
- Hoffmann La Roche
- What technology area does this patent fall under?
- Primary CPC classification C07K14/47. Mapped technology areas include Chemistry & Metallurgy.
- When was this patent published?
- Publication date Tue Apr 05 2016 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
- What related patents are in patentsdb?
- We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).