Compositions and methods for the treatment of viral infections

Patent metadata

Field	Value
Publication number	US-9290545-B2
Application number	US-86437510-A
Country	US
Kind code	B2
Filing date	Jul 23, 2010
Priority date	Jan 23, 2008
Publication date	Mar 22, 2016
Grant date	Mar 22, 2016

Abstract

The invention provides compositions, kits and methods utilizing polypeptides having a viral alpha-helix heptad repeat domain in a stabilized α-helical structure (herein also referred to as SAH). The compositions are useful for treating and/or preventing viral infections. The invention is based, at least in part, on the result provided herein demonstrating that viral hydrocarbon stapled alpha helical peptides display excellent proteolytic, acid, and thermal stability, restore the native alpha-helical structure of the peptide, are highly effective in interfering with the viral fusogenic process, and possess superior pharmacokinetic properties compared to the corresponding unmodified peptides.

First claim

What is claimed is:

1. A modified polypeptide for oral administration to a subject comprising a stabilized alpha helix of HIV gp41 heptad repeat domain, wherein said stabilized HIV gp41 heptad repeat domain is stabilized with two hydrocarbon staples, wherein said hydrocarbon staples are positioned so as to link amino acid residues i and i+4, and wherein said polypeptide is detectable intact in the blood of a subject 30 minutes after oral administration of said polypeptide to said subject.

2. The modified polypeptide of claim 1 , wherein said modified polypeptide is 20 or more amino acids.

3. The modified polypeptide of claim 1 , wherein said heptad repeat domain comprises the formula:
--W--W---I--Y---I--L---S--Q---N--E---L, or conservative amino acid substitutions thereof and wherein “-” can be any amino acid (SEQ ID NO: 44).

4. The modified polypeptide of claim 1 , wherein said heptad repeat domain comprises the formula:
-TW--WDR-I--Y---I--LI---Q--QEK-E--L-EL, or conservative amino acid substitutions thereof and wherein “-” can be any amino acid (SEQ ID NO: 45).

5. The modified polypeptide of claim 1 , wherein said modified polypeptide has at least 10%, 20%, 30%, 50%, 60%, 70%, 80%, or 90% alpha helicity in aqueous solution as determined by circular dichroism.

6. The modified polypeptide of claim 1 , wherein said heptad repeat domain is an HIV-1 gp41 heptad repeat domain 1, an HIV-1 gp41 heptad repeat domain 2, an HIV-2 gp41 heptad repeat domain 1, or an HIV-2 gp41 heptad repeat domain 2.

7. The modified polypeptide of claim 1 , wherein said modified polypeptide is a chimera.

8. The modified polypeptide of claim 7 , wherein said chimera has the amino acid sequence of WQEWEQKITALLEQAQIQQEKNEYELQKLDKWASLWEWF (SEQ ID NO: 46).

9. The modified polypeptide of claim 1 , wherein said heptad repeat domain forms an alpha helix and is 30% or more identical to the amino acid sequence selected from the group consisting of: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF (SEQ ID NO:1), NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLQDQ (SEQ ID NO:2), BTWBEWDREINNYTSLIHSL (SEQ ID NO:3), MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLE (SEQ ID NO:13), YTHIIYSLIEQSQNQQEKNEQELLALDKWASLWNWF (SEQ ID NO:58), and MTMKWEREIDNYTHIIYSLIEQSQNQQEKNEQELLA (SEQ ID NO:59).

10. The modified polypeptide of claim 1 , wherein said modified polypeptide has a formula selected from the group consisting of:

(SEQ ID NO: 20)

BTWBXWDRXINNYTSLIHSLIEXSQNXQEKNEQELLE,

(SEQ ID NO: 22)

BTWBXWDRXINNYTSLIHSLIEESQNQQXKNEXELLE,

(SEQ ID NO: 23)

BTWBEWDXEINXYTSLIHSLIEESQNQQXKNEXELLE,

(SEQ ID NO: 24)

BTWBEWDREINXYTSXIHSLIEESQNQQXKNEXELLE,

(SEQ ID NO: 25)

BTWBEWDREINNYTSXIHSXIEESQNQQXKNEXELLE,

(SEQ ID NO: 35)

YTSLIHSLIEXSQNXQEKNEQXLLEXDKWASLWNWF,

(SEQ ID NO: 36)

YTSXIHSXIEESQNQQEKNEQELLELDKWXSLWXWF,

(SEQ ID NO: 37)

YTSLIHSLIEESQNQQXKNEXELLELDKWXSLWXWF,

(SEQ ID NO: 38)

YTSXIHSXIEESQNQQXKNEXELLELDKWASLWNWF,

(SEQ ID NO: 39)

YTSXIHSXIEESQNQQEKNEQELLELDXWASXWNWF,

(SEQ ID NO: 40)

YTSLIHSLIEXSQNXQEKNEQELLELDXWASXWNWF,

(SEQ ID NO: 42)

BTWBXWDRXINNYTSLIHSLIEESQNQXEKNXQELLE,

(SEQ ID NO: 43)

BTWBXWDRXINNYTSLIHSLIEESQNXQEKXEQELLE; 

and

(SEQ ID NO: 82)

BTWXEWDXEINNYTSLIHSLIEESQNQXEKNXQELLE;

wherein X is any amino acid and further identifies the amino acid residues which are linked by a hydrocarbon staple, and B is methionine or norleucine.

11. A kit comprising the modified polypeptide of claim 1 and instructions for use.

Assignees

• Walensky Loren D
• Bird Gregory H
• Dana Farber Cancer Inst Inc

Inventors

• Walensky Loren D
• Bird Gregory H

Classifications

• A61P31/16

  for influenza or rhinoviruses · CPC title

• A61P31/12

  Antivirals · CPC title

• A61P31/14

  for RNA viruses · CPC title

• A61P31/18

  for HIV · CPC title

• C07K16/1145

  Env proteins, e.g. gp41, gp110/120, gp160, V3, principal neutralising domain [PND] or CD4-binding site · CPC title