Combinations and uses thereof

Patent metadata

Field	Value
Publication number	US-9289490-B2
Application number	US-201414500366-A
Country	US
Kind code	B2
Filing date	Sep 29, 2014
Priority date	Sep 27, 2010
Publication date	Mar 22, 2016
Grant date	Mar 22, 2016

Abstract

The present disclosure describes a pharmaceutical combination of an anti-CD38 antibody and lenalidomide and a pharmaceutical combination of an anti-CD38 antibody and bortezomib.

First claim

We claim:

1. A method for treating multiple myeloma or non-hodgkins lymphoma in a subject in need thereof, wherein said method comprises administering to the subject a therapeutically effective amount of a combination of:
(i) thalidomide, a thalidomide analog, lenalidomide, or pomalidomide and
(ii) an antibody specific for CD38, comprising an HCDR1 region of sequence SYYMN (SEQ ID NO: 14) or GFTFSSYYMN (SEQ ID NO: 1), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 2), an HCDR3 region of sequence DLPLVYTGFAY (SEQ ID NO: 3), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 4), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 5), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 6).

2. The method of claim 1 , wherein said antibody comprises an HCDR1 region of sequence SYYMN (SEQ ID NO: 14).

3. The method of claim 1 , wherein said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1).

4. The method of claim 1 , wherein said antibody comprises a variable heavy chain of the sequence:

(SEQ ID NO: 10)

QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVS

GISGDPSNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

DLPLVYTGFAYWGQGTLVTVSS;

and a variable light chain of the sequence:

(SEQ ID NO: 11)

DIELTQPPSVSVAPGQTARISCSGDNLRHYYVYWYQQKPGQAPVLVIYG

DSKRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCQTYTGGASLVF

GGGTKLTVLGQ.

5. The method of claim 1 , wherein said antibody is an IgG antibody.

6. The method of claim 1 , wherein said antibody comprises an IgG1 Fc region.

7. The method of claim 1 , wherein said antibody comprises a modified Fc region, wherein said modification enhances ADCC activity.

8. The method of claim 1 , wherein said combination comprises said antibody and thalidomide.

9. The method of claim 8 , wherein said cancer is multiple myeloma.

10. The method of claim 1 , wherein said combination comprises said antibody and lenalidomide.

11. The method of claim 10 , wherein said cancer is multiple myeloma.

12. The method of claim 1 , wherein said combination comprises said antibody and pomalidomide.

13. The method of claim 12 , wherein said cancer is multiple myeloma.

14. The method of claim 1 , wherein said antibody and said thalidomide, thalidomide analog, lenalidomide, or pomalidomide are administered separately.

15. The method of claim 8 , wherein said antibody and said thalidomide are administered separately.

16. The method of claim 10 , wherein said antibody and said lenalidomide are administered separately.

17. The method of claim 12 , wherein said antibody and said pomalidomide are administered separately.

18. The method of claim 9 , wherein said antibody and said thalidomide are administered separately.

19. The method of claim 11 , wherein said antibody and said lenalidomide are administered separately.

20. The method of claim 13 , wherein said antibody and said pomalidomide are administered separately.

Assignees

• Morphosys Ag

Inventors

• Rojkjaer Lisa
• Boxhammer Rainer
• Endell Jan
• Winderlich Mark
• Samuelsson Christofer

Classifications

• A61P35/02

  specific for leukemia · CPC title

• A61P43/00

  Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title

• A61P35/00

  Antineoplastic agents · CPC title

• A61K39/39558 Primary

  against tumor tissues, cells, antigens · CPC title

• A61K2039/505

  comprising antibodies · CPC title