Immunoglobulin-binding polypeptide

US9284354B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-9284354-B2
Application numberUS-201214007211-A
CountryUS
Kind codeB2
Filing dateMar 26, 2012
Priority dateMar 25, 2011
Publication dateMar 15, 2016
Grant dateMar 15, 2016

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

An object of the present invention is to provide novel polypeptides that are capable of binding to an immunoglobulin and have high stability against alkali. The present invention relates to proteins having the amino acid sequence of SEQ ID No:1 or 2.

First claim

Opening claim text (preview).

The invention claimed is: 1. A polypeptide, that binds to a protein comprising an Fc region of an immunoglobulin, the polypeptide comprising the following amino acid sequence: (SEQ ID NO: 47) RFX 1 X 2 EQQNAFYEILHX 3 PNLTEEQRNX 4 FIQX 5 LX 6 X 7 X 8 PSVSREX 9 L AEAX 10 X 11 LNDAQAPX 12 wherein X 1 is D, E, N, or Q; X 2 is E or R; X 3 is L, M, or I; X 4 is A, E, F, R, Y, or W; X 5 is D, E, H, I, L, Q, R, S, T, or V; X 6 is H, I, or R; X 7 is D, I, or R; X 8 is D or E; X 9 is I, L, or V; X 10 is R or Q; X 11 is H or R; and X 12 is R, G, or K. 2. A polypeptide, that binds to a protein comprising an Fc region of an immunoglobulin, the polypeptide comprising the following amino acid sequence: (SEQ ID NO: 48) Z 1 Z 2 Z 3 RFX 1 X 2 EQQNAFYEILHX 3 PNLTEEQRNX 4 FIQX 5 LX 6 X 7 X 8 PSVS REX 9 LAEAX 10 X 11 LNDAQAPX 12 wherein X 1 is D, E, N, or Q; X 2 is E or R; X 3 is L, M, or I; X 4 is A, E, F, R, Y, or W; X 5 is D, E, H, I, L, Q, R, S, T, or V; X 6 is H, I, or R; X 7 is D, I, or R; X 8 is D or E; X 9 is I, L, or V; X 10 is R or Q; X 11 is H or R; X 12 is R, G, or K; and Z 1 to Z 3 are each independently A, D, E, G, H, I, L, N, Q, R, S, T, V, or Y. 3. The polypeptide according to claim 1 , which has at least 90% sequence identity to one of the following amino acid sequences: (SEQ ID No: 1) ADNRFNREQQNAFYEILHLPNLTEEQRNAFIQSLRDDPSVSREILAEAR RLNDAQAPG and (SEQ ID No: 2) ADNRFNREQQNAFYEILHLPNLTEEQRNAFIQSLRDDPSVSREILAEAR RLNDAQAPR. 4. The polypeptide according to claim 2 , which has at least 90% sequence identity to one of the following amino acid sequences: (SEQ ID No: 1) ADNRFNREQQNAFYEILHLPNLTEEQRNAFIQSLRDDPSVSREILAEAR RLNDAQAPG and (SEQ ID No: 2) ADNRFNREQQNAFYEILHLPNLTEEQRNAFIQSLRDDPSVSREILAEAR RLNDAQAPR.

Assignees

Inventors

Classifications

  • from mammals · CPC title

  • C07K14/00Primary

    Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof · CPC title

  • C07K14/31Primary

    from Staphylococcus (G) · CPC title

  • C12N15/09Primary

    Recombinant DNA-technology · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US9284354B2 cover?
An object of the present invention is to provide novel polypeptides that are capable of binding to an immunoglobulin and have high stability against alkali. The present invention relates to proteins having the amino acid sequence of SEQ ID No:1 or 2.
Who is the assignee on this patent?
Yoshida Shinichi, Murata Dai, Taira Shunichi, and 1 more
What technology area does this patent fall under?
Primary CPC classification C07K14/00. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Mar 15 2016 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).