Thioredoxin 1 epitope and monoclonal antibody specifically binding thereto
US-2024248090-A1 · Jul 25, 2024 · US
US9284354B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-9284354-B2 |
| Application number | US-201214007211-A |
| Country | US |
| Kind code | B2 |
| Filing date | Mar 26, 2012 |
| Priority date | Mar 25, 2011 |
| Publication date | Mar 15, 2016 |
| Grant date | Mar 15, 2016 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
An object of the present invention is to provide novel polypeptides that are capable of binding to an immunoglobulin and have high stability against alkali. The present invention relates to proteins having the amino acid sequence of SEQ ID No:1 or 2.
Opening claim text (preview).
The invention claimed is: 1. A polypeptide, that binds to a protein comprising an Fc region of an immunoglobulin, the polypeptide comprising the following amino acid sequence: (SEQ ID NO: 47) RFX 1 X 2 EQQNAFYEILHX 3 PNLTEEQRNX 4 FIQX 5 LX 6 X 7 X 8 PSVSREX 9 L AEAX 10 X 11 LNDAQAPX 12 wherein X 1 is D, E, N, or Q; X 2 is E or R; X 3 is L, M, or I; X 4 is A, E, F, R, Y, or W; X 5 is D, E, H, I, L, Q, R, S, T, or V; X 6 is H, I, or R; X 7 is D, I, or R; X 8 is D or E; X 9 is I, L, or V; X 10 is R or Q; X 11 is H or R; and X 12 is R, G, or K. 2. A polypeptide, that binds to a protein comprising an Fc region of an immunoglobulin, the polypeptide comprising the following amino acid sequence: (SEQ ID NO: 48) Z 1 Z 2 Z 3 RFX 1 X 2 EQQNAFYEILHX 3 PNLTEEQRNX 4 FIQX 5 LX 6 X 7 X 8 PSVS REX 9 LAEAX 10 X 11 LNDAQAPX 12 wherein X 1 is D, E, N, or Q; X 2 is E or R; X 3 is L, M, or I; X 4 is A, E, F, R, Y, or W; X 5 is D, E, H, I, L, Q, R, S, T, or V; X 6 is H, I, or R; X 7 is D, I, or R; X 8 is D or E; X 9 is I, L, or V; X 10 is R or Q; X 11 is H or R; X 12 is R, G, or K; and Z 1 to Z 3 are each independently A, D, E, G, H, I, L, N, Q, R, S, T, V, or Y. 3. The polypeptide according to claim 1 , which has at least 90% sequence identity to one of the following amino acid sequences: (SEQ ID No: 1) ADNRFNREQQNAFYEILHLPNLTEEQRNAFIQSLRDDPSVSREILAEAR RLNDAQAPG and (SEQ ID No: 2) ADNRFNREQQNAFYEILHLPNLTEEQRNAFIQSLRDDPSVSREILAEAR RLNDAQAPR. 4. The polypeptide according to claim 2 , which has at least 90% sequence identity to one of the following amino acid sequences: (SEQ ID No: 1) ADNRFNREQQNAFYEILHLPNLTEEQRNAFIQSLRDDPSVSREILAEAR RLNDAQAPG and (SEQ ID No: 2) ADNRFNREQQNAFYEILHLPNLTEEQRNAFIQSLRDDPSVSREILAEAR RLNDAQAPR.
Related publications grouped by family.
Answers are generated from the same data shown on this page.