Graft trussing and suspension construct
US-2024358496-A1 · Oct 31, 2024 · US
Matrix scaffold with antimicrobial activity
US8969290B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-8969290-B2 |
| Application number | US-201313928245-A |
| Country | US |
| Kind code | B2 |
| Filing date | Jun 26, 2013 |
| Priority date | Jun 26, 2012 |
| Publication date | Mar 3, 2015 |
| Grant date | Mar 3, 2015 |
How to read this patent
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
- Title
What the patent document calls the invention.
- Abstract
A short plain-language summary of the technical disclosure.
- Assignees and inventors
Who owns or filed the patent and who is credited as inventor.
- Key dates
Filing, priority, publication, and grant dates set the timeline.
- First independent claim
The legal scope of protection — read this for what is actually claimed.
- CPC / IPC classifications
Technology tags used to group this patent with similar filings.
- Citations and related patents
Prior art links and similar publications in this corpus.
Abstract
Official abstract text for this publication.
The invention provides a scaffold of extracellular matrix polymers with recombinant chimeric peptides tethered thereto. The invention also provides recombinant chimeric peptides of antimicrobial peptides and extracellular matrix binding domains. The invention also provides methods for treating chronic wounds using the scaffold and/or recombinant chimeric peptides.
First claim
Opening claim text (preview).
What is claimed is: 1. A chimeric peptide comprising MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLL DLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQA RGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (SEQ ID NO: 4) and a collagen binding domain selected from the group consisting of TKKTLRT (SEQ ID NO: 5) and CQDSETGTFY (SEQ ID NO: 6), attached to the C-terminal end of SEQ ID NO: 4 via a linker sequence comprising five aspartic acid residues, two lysine re…
Assignees
Inventors
Classifications
Patent family
Related publications grouped by family.
External sources
Next steps
Free tools are coming soon. Tell us what you want to track and we'll notify you.
Frequently asked questions
Answers are generated from the same data shown on this page.
- What does patent US8969290B2 cover?
- The invention provides a scaffold of extracellular matrix polymers with recombinant chimeric peptides tethered thereto. The invention also provides recombinant chimeric peptides of antimicrobial peptides and extracellular matrix binding domains. The invention also provides methods for treating chronic wounds using the scaffold and/or recombinant chimeric peptides.
- Who is the assignee on this patent?
- Rolle Marsha, Prifti Fioleda, Malcuit Chris, and 4 more
- What technology area does this patent fall under?
- Primary CPC classification A61L27/54. Mapped technology areas include Human Necessities.
- When was this patent published?
- Publication date Tue Mar 03 2015 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
- What related patents are in patentsdb?
- We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).