Split ch2 domains

US2023103563A1 · US · A1

Patent metadata
FieldValue
Publication numberUS-2023103563-A1
Application numberUS-202117908190-A
CountryUS
Kind codeA1
Filing dateMar 29, 2021
Priority dateMar 30, 2020
Publication dateApr 6, 2023
Grant date

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The invention relates to a protein complex comprising at least two polypeptide chains A (PCA) and B (PCB), wherein PCA comprises a heterodimerization domain A (HDA) and PCB comprises a heterodimerization domain B (HDB), wherein HDA and HDB bind to each other and wherein one heterodimerization domain comprises or consists of two N-terminal β-strands (N-β) of an immunoglobulin (Ig) domain and the other heterodimerization domain comprises or consists of two C-terminal β-strands (C-β) of an Ig domain. The invention further relates to polynucleotides encoding one or more polypeptides of the protein complex, expression vectors comprising the polynucleotides and a cell comprising the polynucleotides or the expression vectors.

First claim

Opening claim text (preview).

1 . A protein complex comprising at least two polypeptide chains A (PCA) and B (PCB), wherein PCA comprises a heterodimerization domain A (HDA) and PCB comprises a heterodimerization domain B (HDB) that bind to each other and wherein one heterodimerization domain comprises or consists of two N-terminal ß-strands of an immunoglobulin (Ig) domain (N-ß) and the other heterodimerization domain comprises or consists of two C-terminal ß-strands of an Ig domain (C-ß). 2 . The protein complex according to claim 1 , wherein a. N-ß comprises a continuous amino acid sequence of an Ig domain comprising at least ß-strand b and c and b. C-ß comprises a continuous amino acid sequence of an Ig domain comprising at least ß-strand e and f. 3 . The protein complex according to claim 1 or 2 , wherein the Ig domains of N-ß and C-ß are independently selected from an IgA, IgD, IgE, IgG, IgG1, IgG2, IgG3, or IgG4 heavy chain constant domain 2 (CH2), and an IgM or IgE heavy chain constant domain 3 (CH3), and are optionally selected from the same CH2 or CH3. 4 . The protein complex according to claim 1 , wherein HDA and HDB (i) non-covalently or (ii) non-covalently and covalently bind to each other. 5 . The protein complex according to claim 3 , wherein N-ß comprises or consists of a continuous amino acid sequence of a CH2 or CH3 domain comprising or consisting of ß-strand a to ß-strand c and C-ß comprises or consists of a continuous amino acid sequence of a CH2 or CH3 domain comprising or consisting of ß-strand e to ß-strand g. 6 . The protein complex according to claim 1 , wherein the N-ß and C-ß each comprise a non-naturally occurring Cys residue and wherein the Cys residues replace amino acids in the folded N-ß and C-ß, respectively, that naturally have a distance of between 3 to 7.5 Å between their Cα-atoms. 7 . The protein complex according to claim 1 , wherein HDA comprises or consists of: PSVFLFPPKPKDTLMISRTPEVTCVVVDVSX 1 EDPEVX 2 FX 3 WYVDGVEVHN (SEQ ID NO: 1), wherein X 1 is H or Q, X 2 is K or Q and X 3 is N or K; or a variant thereof with an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98% identity to SEQ ID NO: 1; and/or HDB comprises or consists of: NSTX 4 RVVSVLTVX 5 HQDWLNGKEYKCKVSNKX 6 LPX 7 X 8 IEKTI (SEQ ID NO: 2), wherein X 4 is Y or F; X 5 is L or V; X 6 is A or G; X 7 is K or Q; X 8 is N or K; or a variant thereof with an amino acid sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98% identity to SEQ ID NO: 2, wherein SEQ ID NO: 1 or its variant can heterodimerize with SEQ ID NO: 2 or its variant. 8 . The protein complex according to claim 1 , wherein the complex comprises one or more antigen binding sites within the PCA and/or the PCB, wherein each of the one or more antigen binding sites is formed by a pair of two domains, wherein one is comprised in the PCA and the other is comprised in the PCB, and wherein the antigen binding site(s) are located N- and/or C-terminally of the HDA or HDB. 9 . The protein complex according to claim 1 , wherein the PCA and/or the PCB comprises one or more further homo and/or heterodimerization domain C (HDC), wherein the homodimerization domain is selected from the group consisting of a CH3 domain, a CH2-CH3 domain, or a domain where homodimerization is mediated by a an Ig-like fold, a rossmann- or rossmann-like alpha-beta-alpha sandwich fold, an alpha-sandwich fold, a continuous-beta-sheet fold, a beta-sandwich fold, a mixed beta-sheet fold, a 2-helix orientation, an antiparallel alpha-helix-orientation, a parallel alpha-helix orientation, a 4-helix bundle motif, a leucine zipper and a coiled-coil domain and the heterodimerization domain is selected from the group consisting of a knob-into-hole CH3 domain, a knob-into-hole CH2-CH3 domain, a Fc-domain with introduced mutations to force heterodimerization (e.g. charged mutations), a domain of a pair of interchanged domains (such as Fc-one/kappa heterodimerization domain, CL and CH domains), an Ig-like fold with introduced mutations to force heterodimerization, or a domain mediating heterodimerization containing a rossmann- or rossmann-like alpha-beta-alpha sandwich fold, an alpha-sandwich fold, a continuous-beta-sheet fold, a beta-sandwich fold, a mixed beta-sheet fold, a 2-helix orientation, an antiparallel alpha-helix-orientation, a parallel alpha-helix orientation, a 4-helix bundle motif, a leucine zipper and a coiled-coil domain; wherein the antigen binding site(s) are located N- and/or C-terminally of the HDC. 10 . The protein complex according to claim 8 , wherein PCA and PCB comprise from N- to C-terminus the following elements: (i) PCA: V2-L1-HDA, and PCB: V2-L2-HDB; (ii) PCA: V1-L3-HDA-L4-V2, and PCB: V1-L1-HDB-L2-V2; (iii) PCA: V1-L1-V2-L2-HDA, and PCB: V2-L3-V1-L4-HDB; (iv) PCA: V1-L3-V2-L5-CL-L4-HDA, and PCB: V1-L1-V2-L6-CH1-L2-HDB; wherein L5, CL, L6 and CH1 may be present or absent; or (v) PCA: V1-L4-V2-L5-CL-L6-HDA, and PCB: V2-L1-V1-L2-CH1-L3-HDB; wherein L5, CL, L2 and CH1 may be present or absent; wherein each pair of V1, V2, V3, and V4 comprises a variable domain of a heavy chain and a variable domain of a light chain or a variable domain of an alpha chain and a variable domain of a beta chain and forms an antigen binding site, wherein L1 to L6 are peptide linkers, and wherein the PCA and/or the PCB optionally further comprises a HDC. 11 . The protein complex according to claim 10 , wherein the PCA and/or the PCB comprises a first HDC, and wherein the complex comprises one or more additional polypeptides comprising one or more antigen binding sites and a second HDC that is covalently or non-covalently bound to the first HDC. 12 . One or more polynucleotides encoding one or more polypeptides of the protein complex according to claim 1 . 13 . One or more expression vectors comprising the one or more polynucleotides according to claim 12 . 14 . A cell comprising the one or more polynucleotides of claim 12 or one or more expression vectors comprising said one or more polynucleotides. 15 . A pharmaceutical composition comprising a pharmaceutically acceptable carrier and the protein complex according to claim 1 , the one or more polynucleotides encoding one or more polypeptides of said protein complex, or one or more expression vectors comprising said one or more polynucleotides.

Assignees

Inventors

Classifications

  • Medicinal preparations containing antigens or antibodies (materials for immunoassay G01N33/53) · CPC title

  • C07K16/247Primary

    IL-4 · CPC title

  • CH2 domain · CPC title

  • Diabody or triabody · CPC title

  • Interleukins [IL] · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US2023103563A1 cover?
The invention relates to a protein complex comprising at least two polypeptide chains A (PCA) and B (PCB), wherein PCA comprises a heterodimerization domain A (HDA) and PCB comprises a heterodimerization domain B (HDB), wherein HDA and HDB bind to each other and wherein one heterodimerization domain comprises or consists of two N-terminal β-strands (N-β) of an immunoglobulin (Ig) domain and the…
Who is the assignee on this patent?
Sanofi Sa
What technology area does this patent fall under?
Primary CPC classification C07K16/247. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Thu Apr 06 2023 00:00:00 GMT+0000 (Coordinated Universal Time) (A1). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).