CD123-specific chimeric antigen receptor redirected t cells and methods of their use
US-11918606-B2 · Mar 5, 2024 · US
Chimeric antigen receptors (CARs) having mutations in the fc spacer region and methods for their use
US12522667B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-12522667-B2 |
| Application number | US-202117510099-A |
| Country | US |
| Kind code | B2 |
| Filing date | Oct 25, 2021 |
| Priority date | Jan 13, 2014 |
| Publication date | Jan 13, 2026 |
| Grant date | Jan 13, 2026 |
How to read this patent
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
- Title
What the patent document calls the invention.
- Abstract
A short plain-language summary of the technical disclosure.
- Assignees and inventors
Who owns or filed the patent and who is credited as inventor.
- Key dates
Filing, priority, publication, and grant dates set the timeline.
- First independent claim
The legal scope of protection — read this for what is actually claimed.
- CPC / IPC classifications
Technology tags used to group this patent with similar filings.
- Citations and related patents
Prior art links and similar publications in this corpus.
Abstract
Official abstract text for this publication.
Chimeric antigen receptors that include an antigen recognition domain; a spacer domain derived from a modified immunoglobulin Fc region having one or more mutations in its CH2 region resulting in impaired binding to an FcR; and an intracellular signaling domain.
First claim
Opening claim text (preview).
What is claimed is: 1 . A recombinant chimeric antigen receptor (CAR) comprising: an antigen recognition domain that targets a cancer associated antigen selected from the group consisting of CD19, CD20, CD123, HER2, IL-13 receptor α2, prostate stem cell antigen (PSCA), prostate-specific membrane antigen (PSMA), and tumor-associated glycoprotein-72 (TAG-72); a spacer domain comprising the amino acid sequence ESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKT KPREEQFQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEA LHNHYTQKSLSLSLGK (SEQ ID NO: 19); a transmembrane domain; a co-stimulatory intracellular signaling domain selected from the group consisting of: CD28, ICOS, OX40, CD27, DAP10, 4-1BB, p56lck, and 2B4; and a T cell receptor (TCR) zeta chain signaling domain. 2 . The chimeric antigen receptor of claim 1 , wherein the co-stimulatory intracellular signaling domain is 4-1BB. 3 . The chimeric antigen receptor of claim 1 , wherein the co-stimulatory intracellular signaling domain is CD28. 4 . The chimeric antigen receptor of claim 1 , wherein the antigen recognition domain targets IL-13 receptor α2. 5 . The chimeric antigen receptor of claim 1 , wherein the antigen recognition domain is an scFv. 6 . The chimeric antigen receptor of claim 5 , wherein the antigen recognition domain is an scFv that targets CD19 and comprises a light chain variable domain comprising the amino acid sequence of SEQ ID NO:1 and a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2.
Assignees
Inventors
Classifications
containing a transmembrane segment · CPC title
containing a signal sequence · CPC title
Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value · CPC title
variable (Fv) region, i.e. VH and/or VL · CPC title
Hinge · CPC title
Patent family
Related publications grouped by family.
External sources
Frequently asked questions
Answers are generated from the same data shown on this page.
- What does patent US12522667B2 cover?
- Chimeric antigen receptors that include an antigen recognition domain; a spacer domain derived from a modified immunoglobulin Fc region having one or more mutations in its CH2 region resulting in impaired binding to an FcR; and an intracellular signaling domain.
- Who is the assignee on this patent?
- Hope City
- What technology area does this patent fall under?
- Primary CPC classification C07K16/30. Mapped technology areas include Chemistry & Metallurgy.
- When was this patent published?
- Publication date Tue Jan 13 2026 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
- What related patents are in patentsdb?
- We list 9 related publications on this page (citations in our corpus or others sharing the same primary CPC).