CLAUDIN18 antibodies and methods of treating cancer

Patent metadata

Field	Value
Publication number	US-12345709-B2
Application number	US-202017627540-A
Country	US
Kind code	B2
Filing date	Jul 17, 2020
Priority date	Jul 17, 2019
Publication date	Jul 1, 2025
Grant date	Jul 1, 2025

Abstract

The present disclosure provides antigen-binding proteins which bind to Claudin-18.2 (CLDN18.2); bispecific antigen-binding proteins which bind to CLDN18.2 and a second antigen; and conjugates thereof. In various aspects, the antigen-binding proteins bind to Extracellular Loop 1 (EL1) of the extracellular domain of CLDN18.2. Related polypeptides, nucleic acids, vectors, host cells, and conjugates are further provided herein. Kits and pharmaceutical compositions comprising such entities are moreover provided. Also provided are methods of making an antigen-binding protein and methods of treating a subject having cancer.

First claim

What is claimed is:

1. An antigen-binding protein that binds to a human Claudin 18.2 (CLDN 18.2) protein (SEQ ID NO: 1) comprising:
a. CDR1-3 derived from a heavy chain variable region comprising the amino acid sequence: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYTMSWVRQAPGKGLEWVA TIIIGGSYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRLV KGNAMDYWGQGTLVTVSS (SEQ ID NO 42) or a variant sequence thereof which differs by 1-5 amino acids; and
b. CDR1-3 derived from a light chain variable region comprising the amino acid sequence: DIVMTQSPDSLAVSLGERVTMNCKSSQSLLNSGNQKNYLSWYQQKPGQP PKLLFYWASTRESGVPDRFSGSGSGTDFTLTISSVQAEDVAVYYCONDYS YPFTFGQGTKLEIK (SEQ ID NO 45) or a variant sequence thereof which differs by 1-5 amino acids.

2. The antigen-binding protein of claim 1 , comprising:
a. a heavy chain CDR1 comprising amino acid sequence GFTFSSYTMS (SEQ ID NO: 64), or a variant sequence thereof which differs by one or two amino acids;
b. a heavy chain CDR2 amino acid sequence TIIIGGSYTY (SEQ ID NO: 65), or a variant sequence thereof which differs by one or two amino acids;
C. a heavy chain CDR3 amino acid sequence LVKGNAMDY (SEQ ID NO: 66), or a variant sequence thereof which differs by one or two amino acids;
d. a light chain CDR1 amino acid sequence KSSQSLLNSGNQKNYLS (SEQ ID NO: 78), or a variant sequence thereof which differs by one or two amino acids;
e. a light chain CDR2 amino acid sequence WASTRES (SEQ ID NO: 79), or a variant sequence thereof which differs by one or two amino acids; and
f. a light chain CDR3 amino acid sequence QNDYSYPFT (SEQ ID NO: 80), or a variant sequence thereof which differs by one or two amino acids.

3. The antigen-binding protein of claim 1 , which is an antibody.

4. The antigen-binding protein of claim 3 , which is a monoclonal antibody or a humanized antibody.

5. The antigen-binding protein of claim 3 , which is an IgG antibody.

6. A bispecific antigen-binding protein that binds CLDN18.2 and a second antigen, wherein the antigen-binding protein that binds CLDN18.2 is an antigen-binding protein of claim 1 .

7. The bispecific antigen-binding protein of claim 6 , wherein the antigen-binding protein that binds CLDN18.2 comprises:
a. a heavy chain CDR1 comprising amino acid sequence GFTFSSYTMS (SEQ ID NO: 64), or a variant sequence thereof which differs by one or two amino acids;
b. a heavy chain CDR2 amino acid sequence TIIIGGSYTY (SEQ ID NO: 65), or a variant sequence thereof which differs by one or two amino acids;
C. a heavy chain CDR3 amino acid sequence LVKGNAMDY (SEQ ID NO: 66), or a variant sequence thereof which differs by one or two amino acids;
d. a light chain CDR1 amino acid sequence KSSQSLLNSGNOKNYLS (SEQ ID NO: 78), or a variant sequence thereof which differs by one or two amino acids;
e. a light chain CDR2 amino acid sequence WASTRES (SEQ ID NO: 79), or a variant sequence thereof which differs by one or two amino acids; and
f. a light chain CDR3 amino acid sequence QNDYSYPFT (SEQ ID NO: 80), or a variant sequence thereof which differs by one or two amino acids.

8. The bispecific antigen-binding protein of claim 6 , wherein the second antigen is a cell surface protein expressed by a T cell or a component of the T-cell receptor (TCR).

9. The bispecific antigen-binding protein of claim 6 , wherein the bispecific antigen-binding protein comprises an scFv, a Fab, a Fab′, a Fv, or a F(ab′) 2 .

10. A conjugate comprising an antigen-binding protein of claim 1 .

11. The conjugate of claim 10 comprising a cytotoxic agent or a chemotherapeutic agent.

12. The conjugate of claim 10 , wherein the antigen-binding protein is an antibody, which is a humanized antibody or a chimeric antibody.

13. The antigen-binding protein of claim 1 , wherein the antigen-binding protein comprises:
a. a heavy chain variable region comprising the amino acid sequence: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYTMSWVRQAPGKGLEWVA TIIIGGSYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRLV KGNAMDYWGQGTLVTVSS (SEQ ID NO 42) or a variant sequence thereof which differs by 1-5 amino acids; and
b. a light chain variable region comprising the amino acid sequence: DIVMTQSPDSLAVSLGERVTMNCKSSQSLLNSGNQKNYLSWYQQKPGQP PKLLFYWASTRESGVPDRFSGSGSGTDFTLTISSVQAEDVAVYYCONDYS YPFTFGQGTKLEIK (SEQ ID NO 45) or a variant sequence thereof which differs by 1-5 amino acids.

14. A bispecific antigen-binding protein that binds CLDN18.2 and a second antigen, wherein the antigen-binding protein that binds CLDN18.2 is an antigen-binding protein of claim 13 .

15. A conjugate comprising an antigen-binding protein of claim 13 .

Assignees

• Univ California

Inventors

• Conklin Dylan
• Mcdermott Martina S
• O'Brien Neil A
• Palazzolo Michael J
• Slamon Dennis

Classifications

• G01N33/57525

  of the liver or pancreas · CPC title

• G01N33/5759

  involving compounds localised on the membrane of tumour or cancer cells · CPC title

• G01N33/57557 Primary

  of other specific parts of the body, e.g. brain · CPC title

• A61K47/68031

  the drug being an auristatin · CPC title

• G01N33/68

  involving proteins, peptides or amino acids {(involving lipoproteins G01N33/92)} · CPC title