Antibody that binds ErbB-2 and ErbB-3

Patent metadata

Field	Value
Publication number	US-12139548-B2
Application number	US-202218047933-A
Country	US
Kind code	B2
Filing date	Oct 19, 2022
Priority date	Feb 28, 2014
Publication date	Nov 12, 2024
Grant date	Nov 12, 2024

Abstract

The invention relates among others to antibodies comprising a first antigen-binding site that binds Erb B-2 and a second antigen-binding site that binds Erb B-3. The antibodies can typically reduce a ligand-induced receptor function of Erb B-3 on a Erb B-2 and Erb B-3 positive cell. Also described are method for the treatment and use of the antibodies in imaging and in the treatment of subjects having an Erb B-2, Erb B-3 or Erb B-2/3 positive tumor.

First claim

The invention claimed is:

1. A method of treating a human subject having an ErbB-2, ErbB-3 or ErbB-2/ErbB-3 positive tumor comprising administering to the subject a bispecific antibody comprising:
a first binding arm that specifically binds to the extracellular domain of a human ErbB2 polypeptide and comprises a heavy chain variable region comprising the CDR1, CDR2, and CDR3 sequences of AYYIN (SEQ ID NO:49), RIYPGSGYTSYAQKFQG (SEQ ID NO:50), and PPVYYDSAWFAY (SEQ ID NO:51), respectively, and a light chain variable region comprising the CDR1, CDR2, and CDR3 sequences of a light chain comprising SEQ ID NO: 87; and
a second binding arm that specifically binds to the extracellular domain of a human ErbB3 polypeptide and comprises a heavy chain variable region comprising the CDR1, CDR2, and CDR3 sequences GYYMH (SEQ ID NO:64), WINPNSGGTNY AQKFQG (SEQ ID NO:65), and DHGSRHFWSYWGFDY (SEQ ID NO:66), respectively, and a light chain variable region comprising the CDR1, CDR2, and CDR3 sequences of a light chain comprising SEQ ID NO: 87.

2. The method of claim 1 , wherein the antibody comprises the light chain comprising the amino acid sequence

(SEQ ID NO: 87)

DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIY

AASSLOSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPTF

GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQ

WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV

THQGLSSPVTKSFNRGEC.

3. The method of claim 1 , wherein the first binding arm comprises a heavy chain variable region comprising SEQ ID NO: 48, the second binding arm comprises a heavy chain variable region comprising SEQ ID NO: 63, and both the first and second binding arms comprise a light chain variable region comprising SEQ ID NO: 87.

4. The method of claim 1 , wherein the first binding arm comprises a heavy chain comprising SEQ ID NO: 88, the second binding arm comprises a heavy chain comprising SEQ ID NO: 89, and both the first and second binding arms comprise a light chain comprising SEQ ID NO: 87.

5. The method of claim 1 , wherein the bispecific antibody comprises two different immunoglobulin heavy chains with compatible heterodimerization domains.

6. The method of claim 5 , wherein the compatible heterodimerization domains are compatible immunoglobulin heavy chain CH3 heterodimerization domains.

7. The method of claim 1 , wherein the subject is administered a pharmaceutical composition comprising the bispecific antibody.

8. The method of claim 1 , further comprising administering to the subject at least one additional therapeutic agent, selected from BYL719, MK-2206, everolimus, saracatinib, paclitaxel, and vorinostat.

9. The method of claim 1 , wherein the tumor is an ErbB-2/ErbB-3 positive tumor.

10. The method of claim 1 , wherein the tumor is an ErbB-2 positive tumor.

11. The method of claim 1 , wherein the tumor is an ErbB-3 positive tumor.

12. The method of claim 8 , wherein the tumor is an ErbB-2/ErbB-3 positive tumor.

13. The method of claim 8 , wherein the tumor is an ErbB-2 positive tumor.

14. The method of claim 8 , wherein the tumor is an ErbB-3 positive tumor.

15. The method of claim 1 , wherein the tumor is a breast tumor, gastric tumor, colorectal tumor, colon tumor, gastro-esophageal tumor, esophageal tumor, endometrial tumor, ovarian tumor, liver tumor, lung tumor including non-small cell lung tumor, clear cell sarcoma, salivary gland tumor, head and neck tumor, brain tumor, bladder tumor, pancreatic tumor, prostate tumor, kidney tumor, skin tumor, or melanoma.

16. The method of claim 1 , wherein the subject has an ErbB-2, ErbB-3 or ErbB-2/ErbB-3 positive tumor having less than 1,000,000 ErbB-2 cell-surface receptors per tumor cell.

17. A method of treating a human subject having an ErbB-2, ErbB-3 or ErbB-2/ErbB-3 positive tumor comprising administering to the subject a bispecific antibody comprising a first and second binding arm;
wherein the first binding arm specifically binds to the extracellular domain of a human ErbB2 polypeptide and comprises a heavy chain variable region comprising SEQ ID NO: 48, and the second binding arm specifically binds to the extracellular domain of a human ErbB3 polypeptide and comprises a heavy chain variable region comprising SEQ ID NO: 63, and wherein both the first and second binding arms comprise a light chain variable region comprising SEQ ID NO: 87.

18. The method of claim 1 , wherein the antibody comprises the light chain variable region comprising the amino acid sequence

(SEQ ID NO: 176)

DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIY

AASSLOSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPTF

GQGTKVEIK.

19. The method of claim 1 , wherein the bispecific antibody is an IgG antibody.

20. The method of claim 1 , wherein CDR numbering of the heavy chain CDR1, CDR2, and CDR3 sequence is according to Kabat.

Assignees

• Merus Nv

Inventors

• Geuijen Cecilia Anna Wilhelmina
• De Kruif Cornelis Adriaan
• Throsby Mark
• Logtenberg Ton
• Bakker Alexander Berthold Hendrik

Classifications

• A61P35/00

  Antineoplastic agents · CPC title

• C07K2317/526

  CH3 domain · CPC title

• C07K2317/24

  containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered · CPC title

• C07K16/30

  from tumour cells · CPC title

• A61K39/39558

  against tumor tissues, cells, antigens · CPC title