Hepatitis C virus peptide compositions and methods of use thereof

US12048742B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-12048742-B2
Application numberUS-201916978486-A
CountryUS
Kind codeB2
Filing dateMar 14, 2019
Priority dateMar 16, 2018
Publication dateJul 30, 2024
Grant dateJul 30, 2024

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The present disclosure provides an immunogenic composition comprising: a) i) a hepatitis C virus (HCV) heterodimeric polypeptide that includes HCV E1 and E2 polypeptides; ii) an HCV E1 polypeptide; or iii) an HCV E2 polypeptide; b) a polypeptide (also referred to herein as a “T-cell epitope polypeptide” or an “HCV T-cell epitope polypeptide”) comprising T-cell epitopes (e.g., CD4+ and CD8+ T-cell epitopes that are conserved among some HCV genotypes and that are presented through one or multiple HLA alleles common within the human population) present in an HCV protein other than E1 and E2; and c) a pharmaceutically acceptable excipient. The present disclosure provides a method of inducing an immune response, in an individual, to an HCV polypeptide.

First claim

Opening claim text (preview).

What is claimed is: 1. An immunogenic composition comprising: a) a TP35-NS3 T-cell epitope polypeptide comprising an amino acid sequence having at least 80% amino acid sequence identity to: KSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSK as set forth by SEQ ID NO:133, wherein the T-cell epitope polypeptide has a length of from 28 amino acids to 35 amino acids; b) a TP50C T-cell epitope polypeptide comprising an amino acid sequence having at least 80% amino acid sequence identity to: GVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRSEGRSWAQPGYP as set forth by SEQ ID NO:148, wherein the T-cell epitope polypeptide has a length of from 40 amino acids to 50 amino acids; c) a TP27 T-cell epitope polypeptide comprising an amino acid sequence having at least 80% amino acid sequence identity to: LEQIKGGRHLIFCHSKKKCDELAAKLT as set forth by SEQ ID NO:188, wherein the TP27 T-cell epitope polypeptide has a length of from 22 amino acids to 27 amino acids; and d) a TP48 T-cell epitope polypeptide comprising an amino acid sequence having at least 80% amino acid sequence identity to: ILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQIL as set forth by SEQ ID NO:268, wherein the T-cell epitope polypeptide has a length of from 45 amino acids to 48 amino acids. 2. The immunogenic composition of claim 1 , comprising: a) a TP35-NS3 T-cell epitope polypeptide comprising an amino acid sequence having at least 95% amino acid sequence identity to: KSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSK as set forth by SEQ ID NO:133, wherein the T-cell epitope polypeptide has a length of from 28 amino acids to 35 amino acids; b) a TP50C T-cell epitope polypeptide comprising an amino acid sequence having at least 95% amino acid sequence identity to: GVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRSEGRSWAQPGYP as set forth by SEQ ID NO:148, wherein the T-cell epitope polypeptide has a length of from 40 amino acids to 50 amino acids; c) a TP27 T-cell epitope polypeptide comprising an amino acid sequence having at least 95% amino acid sequence identity to: LEQIKGGRHLIFCHSKKKCDELAAKLT as set forth by SEQ ID NO:188, wherein the TP27 T-cell epitope polypeptide has a length of from 22 amino acids to 27 amino acids; and d) a TP48 T-cell epitope polypeptide comprising an amino acid sequence having at least 95% amino acid sequence identity to: ILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQIL as set forth by SEQ ID NO:268, wherein the T-cell epitope polypeptide has a length of from 45 amino acids to 48 amino acids. 3. The immunogenic composition of claim 1 , comprising: a) a TP35-NS3 T-cell epitope polypeptide comprising an amino acid sequence having at least 95% amino acid sequence identity to: KSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSK as set forth by SEQ ID NO:133, wherein the T-cell epitope polypeptide has a length of 35 amino acids; b) a TP50C T-cell epitope polypeptide comprising an amino acid sequence having at least 95% amino acid sequence identity to: GVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRSEGRSWAQPGYP as set forth by SEQ ID NO:148, wherein the T-cell epitope polypeptide has a length of 50 amino acids; c) a TP27 T-cell epitope polypeptide comprising an amino acid sequence having at least 95% amino acid sequence identity to: LEQIKGGRHLIFCHSKKKCDELAAKLT as set forth by SEQ ID NO:188, wherein the TP27 T-cell epitope polypeptide has a length of 27 amino acids; and d) a TP48 T-cell epitope polypeptide comprising an amino acid sequence having at least 95% amino acid sequence identity to: ILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQIL as set forth by SEQ ID NO:268, wherein the T-cell epitope polypeptide has a length of 48 amino acids. 4. The immunogenic composition of claim 1 , comprising: a) a TP35-NS3 T-cell epitope polypeptide comprising the amino acid sequence: KSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSK as set forth by SEQ ID NO:133, wherein the T-cell epitope polypeptide has a length of 35 amino acids; b) a TP50C T-cell epitope polypeptide comprising the amino acid sequence: GVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRSEGRSWAQPGYP as set forth by SEQ ID NO:148, wherein the T-cell epitope polypeptide has a length of 50 amino acids; c) a TP27 T-cell epitope polypeptide comprising the amino acid sequence: LEQIKGGRHLIFCHSKKKCDELAAKLT as set forth by SEQ ID NO:188, wherein the TP27 T-cell epitope polypeptide has a length of 27 amino acids; and d) a TP48 T-cell epitope polypeptide comprising the amino acid sequence: ILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQIL as set forth by SEQ ID NO:268, wherein the T-cell epitope polypeptide has a length of 48 amino acids. 5. The immunogenic composition of claim 1 , comprising: a) a TP35-NS3 T-cell epitope polypeptide comprising the amino acid sequence: KSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSK as set forth by SEQ ID NO:133, wherein the T-cell epitope polypeptide has a length of 35 amino acids; b) a TP50C T-cell epitope polypeptide comprising the amino acid sequence: GVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRSEGRSWAQPGYP as set forth by SEQ ID NO:148, wherein the T-cell epitope polypeptide has a length of 50 amino acids; c) a TP27 T-cell epitope polypeptide comprising the amino acid sequence: LEQIKGGRHLIFCHSKKKCDELAAKLR as set forth by SEO ID NO:188, wherein the TP27 T-cell epitope polypeptide has a length of 27 amino acids; and d) a TP48 T-cell epitope polypeptide comprising the amino acid sequence: ILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQIL as set forth by SEQ ID NO:268, wherein the T-cell epitope polypeptide has a length of 48 amino acids. 6. The composition of claim 1 , further comprising a hepatitis C virus (HCV) E1 polypeptide and/or an HCV E2 polypeptide. 7. The composition of claim 6 , wherein the composition comprises an HCV E1 polypeptide and an HCV E2 polypeptide. 8. The composition of claim 7 , wherein the HCV E1 polypeptide and the HCV E2 polypeptide are of the same genotype. 9. The composition of claim 7 , wherein the HCV E1 polypeptide and the HCV E2 polypeptide are of different genotypes. 10. The composition of claim 1 , wherein the adjuvant comprises MF59. 11. The composition of claim 1 , wherein the adjuvant comprises alum. 12. The composition of claim 1 , wherein the adjuvant comprises a glucopyranosyl lipid. 13. A container comprising the immunogenic composition of claim 1 . 14. The container of claim 13 , wherein the container and the composition are sterile. 15. The container of claim 13 , wherein the container is a syringe. 16. A method of inducing an immune response in an individual to a hepatitis C virus (HCV) polypeptide, the method comprising administering to the individual an effective amount of the immunogenic composition of claim 1 . 17. A method of inducing an immune response in an individual to a hepatitis C virus (HCV) polypeptide, the method comprising administering to the individual an effective amount of the immunogenic composition of claim 6 . 18. A method of inducing an immune response in an individual to a hepatitis C virus (HCV) polypeptide, the method comprising administering to the individual an effective amount of the immunogenic composition of claim 7 .

Assignees

Inventors

Classifications

  • Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein · CPC title

  • New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes · CPC title

  • Inorganic adjuvants · CPC title

  • for RNA viruses · CPC title

  • A61P37/04Primary

    Immunostimulants · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US12048742B2 cover?
The present disclosure provides an immunogenic composition comprising: a) i) a hepatitis C virus (HCV) heterodimeric polypeptide that includes HCV E1 and E2 polypeptides; ii) an HCV E1 polypeptide; or iii) an HCV E2 polypeptide; b) a polypeptide (also referred to herein as a “T-cell epitope polypeptide” or an “HCV T-cell epitope polypeptide”) comprising T-cell epitopes (e.g., CD4+ and CD8+ T-ce…
Who is the assignee on this patent?
Univ Alberta
What technology area does this patent fall under?
Primary CPC classification A61P37/04. Mapped technology areas include Human Necessities.
When was this patent published?
Publication date Tue Jul 30 2024 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).