Tissue-directed antibodies and methods of using the same
US-2024342260-A1 · Oct 17, 2024 · US
Leptin antibodies and method of reducing leptin
US12037390B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-12037390-B2 |
| Application number | US-202318365969-A |
| Country | US |
| Kind code | B2 |
| Filing date | Aug 4, 2023 |
| Priority date | Jun 16, 2018 |
| Publication date | Jul 16, 2024 |
| Grant date | Jul 16, 2024 |
How to read this patent
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
- Title
What the patent document calls the invention.
- Abstract
A short plain-language summary of the technical disclosure.
- Assignees and inventors
Who owns or filed the patent and who is credited as inventor.
- Key dates
Filing, priority, publication, and grant dates set the timeline.
- First independent claim
The legal scope of protection — read this for what is actually claimed.
- CPC / IPC classifications
Technology tags used to group this patent with similar filings.
- Citations and related patents
Prior art links and similar publications in this corpus.
Abstract
Official abstract text for this publication.
Antibody antigen binding domains which specifically binds human leptin comprises VH or VL CDR1, CDR2 and CDR3 sequences of an hLept antibody. The antibody antigen binding domains and antibodies thereof are useful to treat obesity and diabetes.
First claim
Opening claim text (preview).
What is claimed is: 1. An isolated antibody designated hLept3 that binds human leptin and comprises V H CDR1, CDR2 and CDR3 sequences: GGTFSSYA (SEQ ID NO:7), IIPIFGTA (SEQ ID NO:8), and ARSQVPSSYYYGMDV (SEQ ID NO:9), and V L CDR1, CDR2 and CDR3 sequences: NSNIGAGYH (SEQ ID NO:20), GDT, and QSYDRSRGGWF (SEQ ID NO:21). 2. The antibody of claim 1 , comprising the V H and V L sequences: (SEQ ID NO: 65) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMG GIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR SQVPSSYYYGMDVWGQGTMVTVSS, and (SEQ ID NO: 66) QSVLTQPPSVSGAPGQRVTISCTGGNSNIGAGYHVHWYQQLPGAAPKLL IYGDTNRPSGVPDRFSGSQSGTSASLAITGLQADDEADYYCQSYDRSRG GWFFGGGTQLTVL 3. The antibody of claim 1 , that is a humanized monoclonal IgG antibody. 4. A method of reducing leptin levels in a human subject, comprising administering an effective amount of the antibody of claim 1 to said subject.
Assignees
Inventors
Classifications
Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value · CPC title
Antagonist effect on antigen, e.g. neutralization or inhibition of binding · CPC title
containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered · CPC title
comprising antibodies · CPC title
Anorexiants; Antiobesity agents · CPC title
Patent family
Related publications grouped by family.
External sources
Frequently asked questions
Answers are generated from the same data shown on this page.
- What does patent US12037390B2 cover?
- Antibody antigen binding domains which specifically binds human leptin comprises VH or VL CDR1, CDR2 and CDR3 sequences of an hLept antibody. The antibody antigen binding domains and antibodies thereof are useful to treat obesity and diabetes.
- Who is the assignee on this patent?
- Univ Texas
- What technology area does this patent fall under?
- Primary CPC classification C07K16/26. Mapped technology areas include Chemistry & Metallurgy.
- When was this patent published?
- Publication date Tue Jul 16 2024 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
- What related patents are in patentsdb?
- We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).