Recombinant HIV-1 envelope proteins and their use
US-11459360-B2 · Oct 4, 2022 · US
US11911482B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-11911482-B2 |
| Application number | US-202017002571-A |
| Country | US |
| Kind code | B2 |
| Filing date | Aug 25, 2020 |
| Priority date | Aug 25, 2020 |
| Publication date | Feb 27, 2024 |
| Grant date | Feb 27, 2024 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
Disclosed herein are self-assembling protein nanoparticles comprising passenger molecules of interest.
Opening claim text (preview).
What is claimed is: 1. A polypeptide comprising (a) a scaffolding protein consisting of an amino acid sequence having 100% sequence identity to SEQ ID NO: 64, (b) a passenger peptide covalently linked thereto, wherein (i) the passenger peptide is a peptide tag, a covalent peptide tag, a protein tag, an enzyme, or an enzyme substrate, and the passenger peptide neither comprises nor consists of SEQ ID NO: 41 or SEQ ID NO: 42, and/or (ii) the passenger peptide is covalently linked to an amino acid selected from the group consisting of: residues 19-26, 131-141, 245-257, 300-304, and 350-357 of SEQ ID NO: 64 or replaces one or more amino acids selected from the group consisting of: residues 19-26, 131-141, 245-257, 300-304, and 350-357 of SEQ ID NO: 64; and (c) optionally, a peptide having a sequence selected from the group consisting of SEQ ID NO: 45, SEQ ID NO: 52, and SEQ ID NO: 56 covalently attached to a terminal end of the scaffolding protein. 2. The polypeptide according to claim 1 , wherein the polypeptide comprises the peptide having SEQ ID NO: 45 covalently attached to the terminal end of the scaffolding protein. 3. The polypeptide according to claim 1 , wherein the polypeptide does not contain the peptide having SEQ ID NO: 45 covalently attached to the terminal end of the scaffolding protein. 4. The polypeptide according to claim 1 , wherein the polypeptide comprises the peptide having SEQ ID NO: 52 covalently attached to the terminal end of the scaffolding protein. 5. The polypeptide according to claim 1 , wherein the polypeptide comprises the peptide having SEQ ID NO: 56 covalently attached to the terminal end of the scaffolding protein. 6. The polypeptide according to claim 1 , wherein the passenger peptide is covalently linked to the amino acid selected from the group consisting of: residues 19-26, 131-141, 245-257, 300-304, and 350-357 of SEQ ID NO: 64. 7. The polypeptide according to claim 1 , wherein the passenger peptide replaces one or more amino acids selected from the group consisting of: residues 19-26, 131-141, 245-257, 300-304, and 350-357 of SEQ ID NO: 64. 8. The polypeptide according to claim 1 , wherein the passenger peptide is covalently linked to residue 19, 20, 21, 22, 23, 24, 25, 26, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 245, 246, 247, 248, 249, 253, 254, 255, 256, 257, 300, 301, 302, 303, 304, 350, 351, 352, 353, 354, 355, 356, or 357 of SEQ ID NO: 64 or replaces one or more amino acids selected from the group consisting of: residues 19, 20, 21, 22, 23, 24, 25, 26, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 245, 246, 247, 248, 249, 253, 254, 255, 256, 257, 300, 301, 302, 303, 304, 350, 351, 352, 353, 354, 355, 356, and 357 of SEQ ID NO: 64. 9. The polypeptide according to claim 1 , wherein the passenger peptide is covalently linked to residue residues 22, 23, 24, 25, 139, 238, 244, 245, 246, 301, 302, 303, 352, 353, 354, 355, or 356 or replaces one or more amino acids selected from the group consisting of: residues 22, 23, 24, 25, 139, 238, 244, 245, 246, 301, 302, 303, 352, 353, 354, 355, and 356 of SEQ ID NO: 64. 10. The polypeptide according to claim 1 , wherein the polypeptide comprises the passenger peptide which is a peptide tag, a covalent peptide tag, a protein tag, an enzyme, or an enzyme substrate. 11. The polypeptide according to claim 1 , wherein the passenger peptide binds another molecule or is cleaved by an enzyme. 12. The polypeptide according to claim 1 , wherein the passenger peptide is an enzyme that is a narrow-specificity protease, whose recognition sequence depends on two or more amino acid positions. 13. The polypeptide according to claim 1 , wherein the passenger peptide is an enzyme that is a protease such as thrombin or TEV protease. 14. The polypeptide according to claim 1 , wherein the passenger peptide comprises or consists of LVPRGSG (SEQ ID NO: 53), GSENLYFQGGS (SEQ ID NO: 54), LPXTG (SEQ ID NO: 65), AHIVMVDAYKPTK (SEQ ID NO: 66), ATHIKFSKRD (SEQ ID NO: 67), CCPGCC (SEQ ID NO: 68), DIPATYEFTDGKHYITNEPIPPK (SEQ ID NO: 69), DLYDDDDK (SEQ ID NO: 70), DPIVMIDNDKPIT (SEQ ID NO: 71), DYKDDDDK (SEQ ID NO: 72), EEEEEE (SEQ ID NO: 73), EQKLISEEDL (SEQ ID NO: 74), EVHTNQDPLD (SEQ ID NO: 75), GAPVPYPDPLEPR (SEQ ID NO: 76), GKPIPNPLLGLDST (SEQ ID NO: 77), GLNDIFEAQKIEWHE (SEQ ID NO: 78), KETAAAKFERQHMDS (SEQ ID NO: 79), KLGDIEFIKVNK (SEQ ID NO: 80), KLGSIEFIKVNK (SEQ ID NO: 81), KRRWKKNFIAVSAANRFKKISSSGAL (SEQ ID NO: 82), MASMTGGQQMG (SEQ ID NO: 83), MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP (SEQ ID NO: 84), PDRVRAVSHWSS (SEQ ID NO: 85), SLAELLNAGLGGS (SEQ ID NO: 86), SRLEEELRRRLTE (SEQ ID NO: 87), TDKDMTITFTNKKDAE (SEQ ID NO: 88), TETSQVAPA (SEQ ID NO: 89), TKENPRSNQEESYDDNES (SEQ ID NO: 90), TQDPSRVG (SEQ ID NO: 91), VPTIVMVDAYKRYK (SEQ ID NO: 92), WSHPQFEK (SEQ ID NO: 93), YPYDVPDYA (SEQ ID NO: 94), or YTDIEMNRLGK (SEQ ID NO: 95). 15. The polypeptide according to claim 1 , wherein the passenger peptide neither comprises nor consists of SEQ ID NO: 41 or SEQ ID NO: 42.
Medicinal preparations containing peptides (peptides containing beta-lactam rings A61K31/00; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, A61K31/00; ergot alkaloids of the cyclic peptide type A61K31/48; containing macromolecular compounds having statistically distributed amino acid units A61K31/74; medicinal preparations containing antigens or antibodies A61K39/00; medicinal preparations characterised by the non-active ingredients, e.g. peptides as drug carriers, A61K47/00) · CPC title
Nuclear-inclusion-a endopeptidase (3.4.22.44) · CPC title
against material not provided for elsewhere {, e.g. haptens, metals, DNA, RNA, amino acids} · CPC title
from mammals · CPC title
Proteinases {, e.g. Endopeptidases (3.4.21-3.4.25)} · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.