Self assembling protein nanoparticles as carrier molecules

US11911482B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-11911482-B2
Application numberUS-202017002571-A
CountryUS
Kind codeB2
Filing dateAug 25, 2020
Priority dateAug 25, 2020
Publication dateFeb 27, 2024
Grant dateFeb 27, 2024

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

Disclosed herein are self-assembling protein nanoparticles comprising passenger molecules of interest.

First claim

Opening claim text (preview).

What is claimed is: 1. A polypeptide comprising (a) a scaffolding protein consisting of an amino acid sequence having 100% sequence identity to SEQ ID NO: 64, (b) a passenger peptide covalently linked thereto, wherein (i) the passenger peptide is a peptide tag, a covalent peptide tag, a protein tag, an enzyme, or an enzyme substrate, and the passenger peptide neither comprises nor consists of SEQ ID NO: 41 or SEQ ID NO: 42, and/or (ii) the passenger peptide is covalently linked to an amino acid selected from the group consisting of: residues 19-26, 131-141, 245-257, 300-304, and 350-357 of SEQ ID NO: 64 or replaces one or more amino acids selected from the group consisting of: residues 19-26, 131-141, 245-257, 300-304, and 350-357 of SEQ ID NO: 64; and (c) optionally, a peptide having a sequence selected from the group consisting of SEQ ID NO: 45, SEQ ID NO: 52, and SEQ ID NO: 56 covalently attached to a terminal end of the scaffolding protein. 2. The polypeptide according to claim 1 , wherein the polypeptide comprises the peptide having SEQ ID NO: 45 covalently attached to the terminal end of the scaffolding protein. 3. The polypeptide according to claim 1 , wherein the polypeptide does not contain the peptide having SEQ ID NO: 45 covalently attached to the terminal end of the scaffolding protein. 4. The polypeptide according to claim 1 , wherein the polypeptide comprises the peptide having SEQ ID NO: 52 covalently attached to the terminal end of the scaffolding protein. 5. The polypeptide according to claim 1 , wherein the polypeptide comprises the peptide having SEQ ID NO: 56 covalently attached to the terminal end of the scaffolding protein. 6. The polypeptide according to claim 1 , wherein the passenger peptide is covalently linked to the amino acid selected from the group consisting of: residues 19-26, 131-141, 245-257, 300-304, and 350-357 of SEQ ID NO: 64. 7. The polypeptide according to claim 1 , wherein the passenger peptide replaces one or more amino acids selected from the group consisting of: residues 19-26, 131-141, 245-257, 300-304, and 350-357 of SEQ ID NO: 64. 8. The polypeptide according to claim 1 , wherein the passenger peptide is covalently linked to residue 19, 20, 21, 22, 23, 24, 25, 26, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 245, 246, 247, 248, 249, 253, 254, 255, 256, 257, 300, 301, 302, 303, 304, 350, 351, 352, 353, 354, 355, 356, or 357 of SEQ ID NO: 64 or replaces one or more amino acids selected from the group consisting of: residues 19, 20, 21, 22, 23, 24, 25, 26, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 245, 246, 247, 248, 249, 253, 254, 255, 256, 257, 300, 301, 302, 303, 304, 350, 351, 352, 353, 354, 355, 356, and 357 of SEQ ID NO: 64. 9. The polypeptide according to claim 1 , wherein the passenger peptide is covalently linked to residue residues 22, 23, 24, 25, 139, 238, 244, 245, 246, 301, 302, 303, 352, 353, 354, 355, or 356 or replaces one or more amino acids selected from the group consisting of: residues 22, 23, 24, 25, 139, 238, 244, 245, 246, 301, 302, 303, 352, 353, 354, 355, and 356 of SEQ ID NO: 64. 10. The polypeptide according to claim 1 , wherein the polypeptide comprises the passenger peptide which is a peptide tag, a covalent peptide tag, a protein tag, an enzyme, or an enzyme substrate. 11. The polypeptide according to claim 1 , wherein the passenger peptide binds another molecule or is cleaved by an enzyme. 12. The polypeptide according to claim 1 , wherein the passenger peptide is an enzyme that is a narrow-specificity protease, whose recognition sequence depends on two or more amino acid positions. 13. The polypeptide according to claim 1 , wherein the passenger peptide is an enzyme that is a protease such as thrombin or TEV protease. 14. The polypeptide according to claim 1 , wherein the passenger peptide comprises or consists of LVPRGSG (SEQ ID NO: 53), GSENLYFQGGS (SEQ ID NO: 54), LPXTG (SEQ ID NO: 65), AHIVMVDAYKPTK (SEQ ID NO: 66), ATHIKFSKRD (SEQ ID NO: 67), CCPGCC (SEQ ID NO: 68), DIPATYEFTDGKHYITNEPIPPK (SEQ ID NO: 69), DLYDDDDK (SEQ ID NO: 70), DPIVMIDNDKPIT (SEQ ID NO: 71), DYKDDDDK (SEQ ID NO: 72), EEEEEE (SEQ ID NO: 73), EQKLISEEDL (SEQ ID NO: 74), EVHTNQDPLD (SEQ ID NO: 75), GAPVPYPDPLEPR (SEQ ID NO: 76), GKPIPNPLLGLDST (SEQ ID NO: 77), GLNDIFEAQKIEWHE (SEQ ID NO: 78), KETAAAKFERQHMDS (SEQ ID NO: 79), KLGDIEFIKVNK (SEQ ID NO: 80), KLGSIEFIKVNK (SEQ ID NO: 81), KRRWKKNFIAVSAANRFKKISSSGAL (SEQ ID NO: 82), MASMTGGQQMG (SEQ ID NO: 83), MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP (SEQ ID NO: 84), PDRVRAVSHWSS (SEQ ID NO: 85), SLAELLNAGLGGS (SEQ ID NO: 86), SRLEEELRRRLTE (SEQ ID NO: 87), TDKDMTITFTNKKDAE (SEQ ID NO: 88), TETSQVAPA (SEQ ID NO: 89), TKENPRSNQEESYDDNES (SEQ ID NO: 90), TQDPSRVG (SEQ ID NO: 91), VPTIVMVDAYKRYK (SEQ ID NO: 92), WSHPQFEK (SEQ ID NO: 93), YPYDVPDYA (SEQ ID NO: 94), or YTDIEMNRLGK (SEQ ID NO: 95). 15. The polypeptide according to claim 1 , wherein the passenger peptide neither comprises nor consists of SEQ ID NO: 41 or SEQ ID NO: 42.

Assignees

Inventors

Classifications

  • Medicinal preparations containing peptides (peptides containing beta-lactam rings A61K31/00; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, A61K31/00; ergot alkaloids of the cyclic peptide type A61K31/48; containing macromolecular compounds having statistically distributed amino acid units A61K31/74; medicinal preparations containing antigens or antibodies A61K39/00; medicinal preparations characterised by the non-active ingredients, e.g. peptides as drug carriers, A61K47/00) · CPC title

  • Nuclear-inclusion-a endopeptidase (3.4.22.44) · CPC title

  • against material not provided for elsewhere {, e.g. haptens, metals, DNA, RNA, amino acids} · CPC title

  • from mammals · CPC title

  • Proteinases {, e.g. Endopeptidases (3.4.21-3.4.25)} · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US11911482B2 cover?
Disclosed herein are self-assembling protein nanoparticles comprising passenger molecules of interest.
Who is the assignee on this patent?
Univ California
What technology area does this patent fall under?
Primary CPC classification A61K47/62. Mapped technology areas include Human Necessities.
When was this patent published?
Publication date Tue Feb 27 2024 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 5 related publications on this page (citations in our corpus or others sharing the same primary CPC).