Methods and nucleic acid molecules for aav vector selection
US-2024417717-A1 · Dec 19, 2024 · US
US11820795B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-11820795-B2 |
| Application number | US-202117559391-A |
| Country | US |
| Kind code | B2 |
| Filing date | Dec 22, 2021 |
| Priority date | Sep 24, 2013 |
| Publication date | Nov 21, 2023 |
| Grant date | Nov 21, 2023 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
The present invention provides recombinant adenoviral compositions and methods for their use in treating disorders associated with epithelial tissues.
Opening claim text (preview).
We claim: 1. A pharmaceutical composition, comprising: a) a first therapeutic agent, wherein the first therapeutic agent comprises a recombinant AdB-2/3 fiber polypeptide, comprising: 1) one or more AdB-2/3 fiber polypeptide shaft domain motifs; 2) an AdB-2/3 fiber polypeptide knob domain operatively linked to and located C-terminal to the one or more AdB-2/3 fiber polypeptide shaft domain motifs, wherein the AdB-2/3 fiber polypeptide knob domain comprises the peptide of any one of SEQ ID NOS: 5-11; and 3) one or more non-AdB-2/3-derived dimerization domains operatively linked to and located N-terminal to the one or more AdB-2/3 fiber polypeptide shaft domain motifs; b) a second therapeutic agent; and c) a pharmaceutically acceptable carrier. 2. The pharmaceutical composition of claim 1 , wherein the second therapeutic agent is a corticosteroid. 3. The pharmaceutical composition of claim 1 , wherein the second therapeutic agent is selected from dexamethasone, prednisone, cyclophosphamide, pentostatin, rituximab, methotrexate, and vincristine. 4. The pharmaceutical composition of claim 1 , wherein the second therapeutic agent is an anti-tumor therapeutic. 5. The pharmaceutical composition of claim 1 , wherein the pharmaceutical composition is formulated for oral administration. 6. The pharmaceutical composition of claim 1 , wherein the pharmaceutical composition is formulated for intravenous administration. 7. The pharmaceutical composition of claim 1 , wherein the AdB-2/3 fiber polypeptide does not include an AdB-2/3 fiber polypeptide tail domain. 8. The pharmaceutical composition of claim 1 , wherein each shaft domain motif is selected from the group consisting of an Ad3 fiber polypeptide shaft domain motif, an Ad7 fiber polypeptide shaft domain motif, an Ad11 fiber polypeptide shaft domain motif, an Ad 14 fiber polypeptide shaft domain motif, an Ad14a fiber polypeptide shaft domain motif, and combinations thereof. 9. The pharmaceutical composition of claim 1 , wherein the one or more AdB-2/3 fiber polypeptide shaft domain motifs comprise 1-22 shaft domain motifs. 10. The pharmaceutical composition of claim 1 , wherein each shaft domain motif comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 43-48. 11. The pharmaceutical composition of claim 1 , wherein the dimerization domain comprises an amino acid sequence selected from the group consisting of EVSALEK (SEQ ID NO:24) and/or KVSALKE (SEQ ID NO: 25). 12. The pharmaceutical composition of claim 1 , wherein the one or more shaft domain motifs are the shaft domain motif of SEQ ID NO:43. 13. The pharmaceutical composition of claim 1 , comprising the amino acid sequence selected from the group consisting of: a) (M/-) (SEQ ID NO: 28) GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGGSGG GSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNGY VTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKYK QTADFSARGFMPSTTAYPFVLPNAGTHNEN FIFGQCYYKASDGALFPL EVTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIR EDD; b) (M/-) (SEQ ID NO: 29) GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGGSGG GSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNGY VTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLEL YK QTADSSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPLE VTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRE DD; c) (M/-) (SEQ ID NO: 30) GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGGSGG GSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNGY VTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKYK QTADFSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPLE VTVMLNKRLPDSRTSYVMTFLWSL AGLAPETTQATLITSPFTFSYIRE DD; d) (M/-) (SEQ ID NO: 31) GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGGSGG GSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNGY VTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKYK QTADFSARGFMPSTTAYPF LPNAGTHNENYIFGQCYYKASDGALFPLE VTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRE DD; e) (M/-) (SEQ ID NO: 32) GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGGSGG GSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGG VNGY VTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLE KYK QTADFSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYY ASDGALFPLE VTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRE DD; f)(M/-) (SEQ ID NO: 33) GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGGSGG GSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNGY VTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKYK QTAD SARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPLE VTVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIRE DD;
Viral vectors · CPC title
Processes for the isolation, preparation or purification of DNA or RNA (chemical preparation of DNA or RNA C07H21/00; preparation of non-structural polynucleotides from microorganisms or with enzymes C12P19/34) · CPC title
Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof (preparing medicinal viral antigen or antibody compositions, e.g. virus vaccines, A61K39/00) · CPC title
Cells of skeletal and connective tissues; Mesenchyme · CPC title
from viruses · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.