Protein sequencing method and reagents
US-9566335-B1 · Feb 14, 2017 · US
US11390653B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-11390653-B2 |
| Application number | US-202016986334-A |
| Country | US |
| Kind code | B2 |
| Filing date | Aug 6, 2020 |
| Priority date | Nov 8, 2018 |
| Publication date | Jul 19, 2022 |
| Grant date | Jul 19, 2022 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
An amino acid-specific binder selectively binds to a binding amino acid. A binder complex selectively identifies the binding amino acid and includes an adjunct attached to the amino acid-specific binder. The adjunct includes a taggant, protein, substrate, or chemical modifier. Selectively identifying an N-terminal amino acid includes anchoring a C-terminal end; contacting an N-terminal amino acid of the anchored analyte with the binder complex; selectively binding when the N-terminal amino acid includes the binding amino acid; producing, by the taggant of the tagged complex, a taggant signal; detecting the taggant signal; and identifying the N-terminal amino acid based on the taggant signal.
Opening claim text (preview).
What is claimed is: 1. A binder complex for selectively identifying an amino acid, the binder complex comprising: an amino acid-specific binder; and an adjunct attached to the amino acid-specific binder, wherein the amino acid-specific binder binds selectively to a binding amino acid, and the amino acid-specific binder comprises the amino acid sequence comprising: a first amino acid sequence comprising X1-C-P-S-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8; a second amino acid sequence comprising X1-C-S-W-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8; a third amino acid sequence comprising X1-P-M-S-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8; a fourth amino acid sequence comprising X1-S-G-R-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8; a fifth amino acid sequence comprising X1-P-M-P-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8; a sixth amino acid sequence comprising X1-P-R-E-X2-V-X3-R-X4-T-X5-S-E-X6-E-X7-G-K-X8; a seventh amino acid sequence comprising X1-P-R-E-X2-E-X3-N-X4-Q-X5-C-T-X6-Q-X7-A-R-X8; or an eighth amino acid sequence comprising X1-P-M-S-X2-E-X3-N-X4-Q-X5-S-T-X6-Q-X7-A-R-X8; wherein: X1 comprises an amino acid sequence comprising SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYT (Sequence ID No. 20); X2 comprises an amino acid sequence comprising FVT; X3 comprises an amino acid sequence comprising VLKAVF (Sequence ID No. 21); X4 comprises an amino acid sequence comprising MSED (Sequence ID No. 22); X5 comprises an amino acid sequence comprising GRRVMMTAHRFGSAVVVV (Sequence ID No. 23); X6 comprises an amino acid sequence comprising RDIAETKAK (Sequence ID No. 24); X7 comprises an amino acid sequence comprising ATDL (Sequence ID No. 25); and X8 comprises an amino acid sequence comprising EAGFPLMFTTEPEE (Sequence ID No. 26), such that a total percentage amount of substitutions and deletions to X1, X2, X3, X4, X5, X6, X7, and X8 is from 0% to less than 30%, exclusive of SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMEFVTVVLKAVFRMSEDTGRRVM MTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEPEE (Sequence ID No. 27), or wherein the amino acid-specific binder comprises the amino acid sequence comprising NLEKIKKLRNVIKEIKKDNIKEADEHEKKE REKETSAWKVILYNDDIHKFSYVTDVIVKVV GQISKAKAHTITVEAHSTGQALILSTQKSKAEKYCQELQQNGLTVSIIHESQLKDKQKK (Sequence ID No. 10). 2. The binder complex of claim 1 , wherein the amino acid sequence comprises: (Sequence ID No. 1) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTCPSFVTVVLK AVFRMSBDTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDL GKEAGFPLMFTTEPEE; (Sequence ID No. 2) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTCSWFVTVVLK AVFRMSEDTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDL GKEAGFPLMFTTEPEE; (Sequence ID No. 3) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMSFVTVVLK AVFRMSEDTGRRVMMTAHRFGSAWWCERDIAETKAKEATDLGK EAGFPLMFTTEPEE; (Sequence ID No. 4) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTSGRFVTVVLK AVFRMSEDTGRRVMMTAHRFGSAVWVCERDIAETKAKEATDLG KEAGFPLMFTTEPEE; (Sequence ID No. 5) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMPFVTVVLK AVFRMSEDTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDL GKEAGFPLMFTTEPEE; (Sequence ID No. 6) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPREFVTVVLK AVFRMSEDTGRRVMMTAHRFGSAVVWSERDIAETKAKEATDLG KEAGFPLMFTTEPEE; (Sequence ID No. 7) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPREFVTEVLK AVFNMSEDQGRRVMMTAHRFGSAVVGVCTRDIAETKAKQATDL AREAGFPLMFTTEPEE; (Sequence ID No. 8) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMSFVTEVLK AVFNMSEDQGRRVMMTAHRFGSAVVGVSTRDIAETKAKQATDL AREAGFPLMFTTEPEE; or (Sequence ID No. 10) NLEKIKKLRNVIKEIKKDNIKEADEHEKKEREKETSAWKVILY NDDIHKFSYVTDVIVKVVGQISKAKAHTITVEAHSTGQALILS TWKSKAEKYCQELQQNGLTVSIIHESQLKDKQKK.
with fluorescent label · CPC title
Labelling of peptides · CPC title
Sequencing of polypeptides · CPC title
from bacteria · CPC title
Plasmodium · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.