Desmoglein 2 (DSG2) binding proteins and uses therefor

US11248028B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-11248028-B2
Application numberUS-202016806617-A
CountryUS
Kind codeB2
Filing dateMar 2, 2020
Priority dateSep 24, 2013
Publication dateFeb 15, 2022
Grant dateFeb 15, 2022

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The present invention provides recombinant adenoviral compositions and methods for their use in treating disorders associated with epithelial tissues.

First claim

Opening claim text (preview).

We claim: 1. A pharmaceutical composition, comprising: (a) a recombinant AdB-2/3 fiber polypeptide, comprising: (i) one or more AdB-2/3 fiber polypeptide shaft domain motifs; (ii) an AdB-2/3 fiber polypeptide knob domain operatively linked to and located C-terminal to the one or more AdB-2/3 fiber polypeptide shaft domain motifs, wherein the AdB-2/3 fiber polypeptide knob domain comprises the peptide of any one of SEQ ID NOS 5-11; and (iii) one or more non-AdB-2/3-derived dimerization domains operatively linked to and located N-terminal to the one or more AdB-2/3 fiber polypeptide shaft domain motifs; and (b) a pharmaceutically acceptable carrier. 2. The pharmaceutical composition of claim 1 , wherein the AdB-2/3 fiber polypeptide does not include an AdB-2/3 fiber polypeptide tail domain. 3. The pharmaceutical composition of claim 1 , wherein each shaft domain motif is selected from the group consisting of an Ad3 fiber polypeptide shaft domain motif, an Ad7 fiber polypeptide shaft domain motif, an Ad11 fiber polypeptide shaft domain motif, an Ad 14 fiber polypeptide shaft domain motif, an Ad14a fiber polypeptide shaft domain motif, and combinations thereof. 4. The pharmaceutical composition of claim 1 , wherein the one or more shaft domain motifs comprise 1-22 shaft domain motifs. 5. The pharmaceutical composition of claim 1 , wherein each shaft domain motif comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 43-48. 6. The pharmaceutical composition of claim 1 , wherein the dimerization domain comprises an amino acid sequence selected from the group consisting of EVSALEK (SEQ ID NO:24) and/or KVSALKE (SEQ ID NO: 25). 7. The pharmaceutical composition of claim 1 wherein the one or more shaft domain motifs are the shaft domain motif of SEQ ID NO:43. 8. The pharmaceutical composition of claim 1 , comprising the amino acid sequence selected from the group consisting of (a) (SEQ ID NO: 28) (M/)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGGS GGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNGY VTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKYKQT ADFSARGFMPSTTAYPFVLPNAGTHNENFIFGQCYYKASDGALFPLEVTVM LNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIREDD; (b) (SEQ ID NO: 29) (M/)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGGS GGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNGY VTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELEYKQT ADSSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPLEVTVM LNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIREDD; (c) (SEQ ID NO: 30) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGG SGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNG YVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKYKQ TADFSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPLEVTV MLNKRLPDSRTSYVMTFLWSLSAGLAPETTQATLITSPFTFSYIREDD; (d) (SEQ ID NO: 31) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGG SGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNG YVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKYKQ TADFSARGFMPSTTAYPFDLPNAGTHNENYIFGQCYYKASDGALFPLEVTV MLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIREDD; (e) (SEQ ID NO: 32) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGG SGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGLVNG YVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLEPKYKQ TADFSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYEASDGALFPLEVTV MLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIREDD; (f) (SEQ ID NO: 33) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGG SGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNG YVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKYKQ TADLSARGFMPSTTAYPFVLPNAGTHNENYIFGQCYYKASDGALFPLEVTV MLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIREDD; and (g) (SEQ ID NO: 34) (M/-)GSKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEGSGGGSGGG SGGGSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNG YVTLMGASDYVNTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKYKQ TADFSARGFMPSTTAYPFVLPNAGTHNGNYIFGQCYYEASDGALFPLEVTV MLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITSPFTFSYIREDD.

Assignees

Inventors

Classifications

  • Viral vectors · CPC title

  • Processes for the isolation, preparation or purification of DNA or RNA (chemical preparation of DNA or RNA C07H21/00; preparation of non-structural polynucleotides from microorganisms or with enzymes C12P19/34) · CPC title

  • Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof (preparing medicinal viral antigen or antibody compositions, e.g. virus vaccines, A61K39/00) · CPC title

  • Cells of skeletal and connective tissues; Mesenchyme · CPC title

  • C07K14/005Primary

    from viruses · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US11248028B2 cover?
The present invention provides recombinant adenoviral compositions and methods for their use in treating disorders associated with epithelial tissues.
Who is the assignee on this patent?
Univ Washington Through Its Center For Commercialization
What technology area does this patent fall under?
Primary CPC classification C07K14/005. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Feb 15 2022 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).