Methods and nucleic acid molecules for aav vector selection
US-2024417717-A1 · Dec 19, 2024 · US
US11225508B1 · US · B1
| Field | Value |
|---|---|
| Publication number | US-11225508-B1 |
| Application number | US-202117173617-A |
| Country | US |
| Kind code | B1 |
| Filing date | Feb 11, 2021 |
| Priority date | Sep 23, 2020 |
| Publication date | Jan 18, 2022 |
| Grant date | Jan 18, 2022 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
This invention relates to SARS-CoV-2 viruses adapted with nanoluciferase reporter molecules and mouse-adapted SARS-CoV-2 viruses, compositions including the same and methods of use thereof.
Opening claim text (preview).
That which is claimed: 1. A recombinant SARS-CoV-2 virus particle comprising a spike protein, wherein the spike protein comprises the amino acid sequence: MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMD LEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSET KCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIA DYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGST PCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKN KCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVS VITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEH VNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPT NFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDK NTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQY GDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIP FAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQN AQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAA EIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKN FTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVN NTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLN ESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCC KFDEDDSEPVLKGVKLHYT (SEQ ID NO:2) or an amino acid sequence at least 90% identical thereto, wherein either said amino acid sequence comprises a substitution of Q498Y and P499T. 2. An isolated nucleic acid molecule encoding the SARS-CoV-2 virus particle of claim 1 . 3. An isolated nucleic acid molecule encoding the SARS-CoV-2 virus particle of claim 1 , wherein the nucleic acid molecule comprises one or more of the following nonsynonymous nucleotide substitutions, wherein the numbering is based on the reference nucleotide sequence of SEQ ID NO:1: G9479T, C9491T, A12678G, A12884G, C23039A, C9438T, A11847G, A12159G, T27221C, C23054T, A23056C, C23057A, C23059G. 4. The isolated nucleic acid molecule of claim 3 , further comprising one or more synonymous nucleotide substitution(s). 5. The isolated nucleic acid molecule of claim 4 , wherein the synonymous nucleotide substitution is T15102A. 6. The isolated nucleic acid molecule of claim 3 , wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:8. 7. The isolated nucleic acid molecule of claim 3 , wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:9. 8. The isolated nucleic acid molecule of claim 3 , wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:10. 9. The isolated nucleic acid molecule of claim 3 , wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:11. 10. The isolated nucleic acid molecule of claim 3 , wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:12. 11. The isolated nucleic acid molecule of claim 3 , wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:15. 12. The isolated nucleic acid molecule of claim 3 , wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:16, 17, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40. 13. A population of SARS-CoV-2 particles comprising the SARS-CoV-2 virus particle of claim 1 . 14. A composition comprising the SARS-CoV-2 virus particle of claim 1 in a pharmaceutically acceptable carrier. 15. A composition comprising the isolated nucleic acid molecule of claim 2 in a pharmaceutically acceptable carrier. 16. A method of producing an immune response to a coronavirus in a subject, comprising administering to the subject an effective amount of the SARS-CoV-2 virus particle of claim 1 . 17. The recombinant SARS-CoV-2 virus particle of claim 1 , wherein the spike protein amino acid sequence further comprises the substitution Q493K. 18. The isolated nucleic acid molecule of claim 2 , wherein the nucleic acid molecule comprises a nucleotide sequence of SEQ ID NO:15. 19. The isolated nucleic acid molecule of claim 2 , wherein the nucleic acid molecule encodes a substitution of Q493K in the spike protein amino acid sequence, and further encodes a SARS-CoV-2 nsp4 protein comprising a T285I, G309C and/or H313Y substitution(s); a SARS-CoV-2 nsp7 protein comprising a K2R substitution; a SARS-CoV-2 nsp8 protein comprising a E23G and/or K196R substitution; a SARS-CoV-2 nsp9 protein comprising a T67A substitution; and/or a SARS-CoV-2 ORF6 protein comprising a F7S substitution, wherein the numbering corresponds to the amino acid sequences of SEQ ID NO:3 (nsp4 protein), SEQ ID NO:4 (nsp7 protein), SEQ ID NO:5 (nsp8 protein), SEQ ID NO:6 (nsp9 protein) or SEQ ID NO:7 (ORF6 protein), respectively. 20. The isolated nucleic acid molecule of claim 19 , wherein the nucleic acid molecule further encodes a SARS-CoV-2 nsp4 protein comprising the amino acid sequence of SEQ ID NO:3, wherein said amino acid sequence comprises a T285I substitution; a SARS-CoV-2 nsp7 protein comprising the amino acid sequence of SEQ ID NO:4, wherein said amino acid sequence comprises a K2R substitution; a SARS-CoV-2 nsp8 protein comprising the amino acid sequence of SEQ ID NO:5, wherein said amino acid sequence comprises a E23G substitution; and a SARS-CoV-2 ORF6 protein comprising the amino acid sequence of SEQ ID NO:7, wherein said amino acid sequence comprises a F7S substitution. 21. The isolated nucleic acid molecule of claim 20 , wherein the nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of SEQ ID NO:8, 9, 10, 11, 12, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, and 40. 22. The isolated nucleic acid molecule of claim 20 , wherein the nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of SEQ ID NO:8 and SEQ ID NO:30.
Virus like particles [VLP] · CPC title
New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes · CPC title
Viruses as such, e.g. new isolates, mutants or their genomic sequences · CPC title
from viruses · CPC title
Humanized animals · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.