COMPOSITIONS AND METHODS RELATED TO ENGINEERED Fc CONSTRUCTS
US-2021221917-A1 · Jul 22, 2021 · US
Engineered Fc constructs
US11220531B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-11220531-B2 |
| Application number | US-201816474640-A |
| Country | US |
| Kind code | B2 |
| Filing date | Jan 5, 2018 |
| Priority date | Jan 6, 2017 |
| Publication date | Jan 11, 2022 |
| Grant date | Jan 11, 2022 |
How to read this patent
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
- Title
What the patent document calls the invention.
- Abstract
A short plain-language summary of the technical disclosure.
- Assignees and inventors
Who owns or filed the patent and who is credited as inventor.
- Key dates
Filing, priority, publication, and grant dates set the timeline.
- First independent claim
The legal scope of protection — read this for what is actually claimed.
- CPC / IPC classifications
Technology tags used to group this patent with similar filings.
- Citations and related patents
Prior art links and similar publications in this corpus.
Abstract
Official abstract text for this publication.
The present disclosure relates to engineered IgG Fc constructs and uses thereof.
First claim
Opening claim text (preview).
The invention claimed is: 1. An Fc construct comprising: a) a first polypeptide comprising i) a first Fc domain monomer; ii) a second Fc domain monomer; and iii) a linker joining the first Fc domain monomer to the second Fc domain monomer; b) a second polypeptide comprising i) a third Fc domain monomer; ii) a fourth Fc domain monomer; and iii) a linker joining the third Fc domain monomer to the fourth Fc domain monomer; c) a third polypeptide comprises a fifth Fc domain monomer; and d) a fourth polypeptide comprises a sixth Fc domain monomer; wherein the first Fc domain monomer and fifth Fe domain monomer combine to forma first Fc domain; the second Fc domain monomer and fourth Fc domain monomer combine to forma second Fc domain; and the third Fc domain monomer and sixth Fc domain monomer combine to forma third Fc domain; wherein each of the first and second polypeptides comprises the sequence (SEQ ID NO: 76) DKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPPEEQYNSTYRVVSVLT VLHQDWLNGKE YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDKLTKNQVSLWCL VKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSL SPGKGGGGGGGGGGGGGGGGGGG GDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWY VDGVEVHNAKTKPPEEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLT CLVKGFYPSDIA VEWESNGQPENNYKTTPPVLKSDGSFFLYSDLT VDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG, with up to 10 single amino acid substitutions, provided that position 72 of SEQ ID NO: 76 is a proline and position 319 of SEQ ID NO: 76 is a proline; and each of the third and fourth polypeptides comprises the sequence (SEQ ID NO: 70) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPPEEQYNSTYRVVSVLT VLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSCAV DGEFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRW QQGNVFSCS VMHEALHNHYTQKSLSLSPG, with up to 10 single amino acid substitutions, provided that position 72 of SEQ ID NO: 70 is a proline. 2. The Fc construct of claim 1 , wherein each of the first and second polypeptides comprises the sequence (SEQ ID NO: 76) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPPEEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDKLTKNQVSLWCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGGGGGGGGGGGGGGGGGDKT HTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWY VDGVEVHNAKTKPPEEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSDLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG, with up to 5 single amino acid substitutions, provided that position 72 of SEQ ID NO: 76 is a proline and position 319 of SEQ ID NO: 76 is a proline; and each of the third and fourth polypeptides comprises the sequence (SEQ ID NO: 70) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPPEEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSCAVD GEFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPG, with up to 5 single amino acid substitutions, provided that position 72 of SEQ ID NO: 70 is a proline. 3. The Fc construct of claim 1 , wherein each of the first and second polypeptides comprises the sequence (SEQ ID NO: 76) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPPEEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDKLTKNQVSLWCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGGGGGGGGGGG
Assignees
Inventors
Classifications
Constant or Fc region; Isotype · CPC title
characterized by non-natural combinations of immunoglobulin fragments · CPC title
- C07K16/00Primary
Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies · CPC title
- C07K16/46Primary
Hybrid immunoglobulins (hybrids of an immunoglobulin with a peptide not being an immunoglobulin C07K19/00) · CPC title
Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto · CPC title
Patent family
Related publications grouped by family.
External sources
Frequently asked questions
Answers are generated from the same data shown on this page.
- What does patent US11220531B2 cover?
- The present disclosure relates to engineered IgG Fc constructs and uses thereof.
- Who is the assignee on this patent?
- Momenta Pharmaceuticals Inc, Janssen Biotech Inc
- What technology area does this patent fall under?
- Primary CPC classification C07K16/00. Mapped technology areas include Chemistry & Metallurgy.
- When was this patent published?
- Publication date Tue Jan 11 2022 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
- What related patents are in patentsdb?
- We list 7 related publications on this page (citations in our corpus or others sharing the same primary CPC).