Specific binding agents to varicella-zoster virus and uses related thereto

US11147870B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-11147870-B2
Application numberUS-201916394360-A
CountryUS
Kind codeB2
Filing dateApr 25, 2019
Priority dateApr 25, 2018
Publication dateOct 19, 2021
Grant dateOct 19, 2021

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

This disclosure relates to specific binding agents to varicella-zoster virus proteins or glycoproteins. In certain embodiments the specific binding agents are antibodies and binding fragments thereof disclosed herein. In certain embodiments, this disclosure relates to methods of treating or preventing a varicella-zoster infection comprising administering an effective amount of a specific binding agent disclosed herein to a subject in need thereof.

First claim

Opening claim text (preview).

What is claimed is: 1. A recombinant chimeric antibody or fragment comprising six complementarity determining regions (CDRs) of antibody RM-2D6, wherein the CDRs comprise three heavy chain CDRs, wherein heavy chain CDR 1 comprises the amino acid sequence of GFMFSSYG (SEQ ID NO: 3); CDR 2 comprises the amino acid sequence of VSHDGTND (SEQ ID NO: 4), and CDR 3 comprises the amino acid sequence of AKTSWARFLEWTFDY (SEQ ID NO: 1), and, wherein the CDRs comprise three light chain CDRs, wherein light chain CDR 1 comprises the amino acid sequence of QSINRY (SEQ ID NO: 5); light chain CDR2 comprises the amino acid sequence of GASS (SEQ ID NO: 6); and light chain CDR3 comprises the amino acid sequence of QQSHSTPT (SEQ ID NO: 2); and, wherein the antibody or fragment specifically binds a glycoprotein of varicella-zoster virus. 2. The antibody of claim 1 , wherein the heavy chain variable region comprises EVQLVESGGGVVQPGRSLRLSCAASGFMFSSYGMHWVRQAPGKGLEWVAAVSHDGT NDLYADSVKGRFSISRDNSKNTLYLQMNSLRAEDTAVYYCAKTSWARFLEWTFDYWG QGTLVTVSS (SEQ ID NO: 7). 3. The antibody of claim 1 , wherein the light chain variable region comprises DIQMTQSPSSLSASVGDRVTITCRASQSINRYLNWYQQKPGKAPKLLIYGASSLQSGVPL RFSGSGSGTDFTLTISSLQPEDFATYYCQQSHSTPTFGQGTRLEIK (SEQ ID NO: 8). 4. A composition comprising the antibody or fragment of claim 1 , and a pharmaceutically acceptable carrier. 5. A recombinant chimeric antibody or fragment comprising six complementarity determining regions (CDRs) of antibody 302-1G9, wherein the CDRs comprise three heavy chain CDRs, wherein heavy chain CDR 1 comprises the amino acid sequence of GYTFSNYG (SEQ ID NO: 11); CDR 2 comprises the amino acid sequence of ISASNANT (SEQ ID NO: 12), and CDR 3 comprises the amino acid sequence of ARDRGGSLAMVVGLDH (SEQ ID NO: 9), and, wherein the CDRs comprise three light chain CDRs, wherein light chain CDR 1 comprises the amino acid sequence of QSIGGY (SEQ ID NO: 13); light chain CDR2 comprises the amino acid sequence of AAST (SEQ ID NO: 14); and light chain CDR3 comprises the amino acid sequence of QQCYSAELT (SEQ ID NO: 10); and, wherein the antibody or fragment specifically binds a glycoprotein of varicella-zoster virus. 6. The antibody of claim 5 , wherein the heavy chain variable region comprises QVQLVQSGAEVKKPGASVKVSCEAFGYTFSNYGFTWVRQAPGQGLEWMGWISASNAN TKYGQKFRGRVTLTTDTSTSTAYMELRNLGYDDTAMYYCARDRGGSLAMVVGLDHW GQGTLVTVSS (SEQ ID NO: 15). 7. The antibody of claim 5 , wherein the light chain variable region comprises DIQMTQSPTSLSASVGDRVTITCRASQSIGGYLNWYQQNPGKAPKLLIYAASTLQRGVPS RFSGGGSGTDFTLTITSLQPEDFATYYCQQCYSAELTFGGGTKVEIK (SEQ ID NO: 16). 8. A composition comprising the antibody or fragment of claim 5 , and a pharmaceutically acceptable carrier.

Assignees

Inventors

Classifications

  • Varicella-zoster virus · CPC title

  • avirulent or attenuated · CPC title

  • containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered · CPC title

  • Viral antigens · CPC title

  • Immunostimulants · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US11147870B2 cover?
This disclosure relates to specific binding agents to varicella-zoster virus proteins or glycoproteins. In certain embodiments the specific binding agents are antibodies and binding fragments thereof disclosed herein. In certain embodiments, this disclosure relates to methods of treating or preventing a varicella-zoster infection comprising administering an effective amount of a specific bindin…
Who is the assignee on this patent?
Univ Emory
What technology area does this patent fall under?
Primary CPC classification A61P31/22. Mapped technology areas include Human Necessities.
When was this patent published?
Publication date Tue Oct 19 2021 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 2 related publications on this page (citations in our corpus or others sharing the same primary CPC).