Compositions and methods for treating hemoglobinopathies

US11142760B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-11142760-B2
Application numberUS-202117214461-A
CountryUS
Kind codeB2
Filing dateMar 26, 2021
Priority dateFeb 13, 2019
Publication dateOct 12, 2021
Grant dateOct 12, 2021

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The present invention features compositions and methods for editing deleterious mutations associated with hemoglobinopathies, such as sickle cell disease (SCD). In particular embodiments, the invention provides methods for correcting mutations in a beta globin polynucleotide using modified adenosine base editors termed “ABE8” having unprecedented levels (e.g., >60-70%) of efficiency.

First claim

Opening claim text (preview).

What is claimed is: 1. A method for editing a beta globin (HBB) polynucleotide associated with sickle cell disease, the method comprising contacting a cell comprising a single nucleotide polymorphism (SNP) in the beta globin (HBB) polynucleotide with a guide RNA and a fusion protein comprising a polynucleotide programmable DNA binding domain and an adenosine deaminase domain comprising a serine (S) at amino acid position 82 of the following amino acid sequence and having at least 85% sequence identity to the following amino acid sequence (SEQ ID NO: 2) MSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNR AIGLHDPTAHAEIMALRQGGLVMQNYRLIDATLYVTFEPCVMCAGAM IHSRIGRVVFGVRNAKTGAAGSLMDVLHYPGMNHRVEITEGILADEC AALLCYFFRMPRQVFNAQKKAQSSTD, wherein said guide RNA targets said polynucleotide programmable DNA binding domain to the SNP in the beta globin (HBB) polynucleotide. 2. The method of claim 1 , wherein the adenosine deaminase domain further comprises an alteration at amino acid position 166. 3. The method of claim 2 , wherein the alteration at amino acid position 166 is T166R. 4. The method of claim 1 , wherein the adenosine deaminase domain further comprises one or more of the following alterations: Y147T, Y147R, Q154S, Y123H, and Q154R. 5. The method of claim 1 , wherein the adenosine deaminase domain comprises a combination of alterations selected from the group consisting of: Y147T and Q154R; Y147T and Q154S; Y147R and Q154S; V82S and Q154S; V82S and Y147R; V82S and Q154R; V82S and Y123H; I76Y and V82S; V82S, Y123H, and Y147T; V82S, Y123H, and Y147R; V82S, Y123H, and Q154R; Y147R, Q154R, and Y123H; Y147R, Q154R, and I76Y; Y147R, Q154R, and T166R; Y123H, Y147R, Q154R, and I76Y; V82S, Y123H, Y147R, and Q154R; and I76Y, V82S, Y123H, Y147R, and Q154R. 6. The method of claim 1 , wherein the adenosine deaminase domain comprises V82S and T166R. 7. The method of claim 1 , wherein the fusion protein comprises a heterodimer comprising the adenosine deaminase domain of claim 1 and a wild-type adenosine deaminase domain. 8. The method of claim 1 , wherein the adenosine deaminase domain comprises Y147T and Q154S. 9. The method of claim 1 , wherein an A•T to G•C alteration at the SNP results in expression of an HBB polypeptide having an alanine at amino acid position 6. 10. The method of claim 1 , wherein the programmable DNA binding domain comprises a Cas9 domain. 11. The method of claim 10 , wherein the Cas9 domain comprises a dead Cas9 (dCas9) or a nickase Cas9 (nCas9). 12. The method of claim 11 , wherein the Cas9 domain is capable of programmable DNA binding and has at least 85% amino acid sequence identity to a Streptococcus pyogenes Cas9 (SpCas9), Staphylococcus aureus Cas9 (SaCas9), or a Streptococcus thermophilus 1 Cas9 (St1Cas9). 13. The method of claim 11 , wherein the Cas9 domain comprises the following amino acid sequence: (SEQ ID NO: 1) MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIG ALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFF HRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTD KADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLF EENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALS LGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAK NLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQL PEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVK LNREDLLRKQRTEDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIE KILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQS FIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAF LSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFN ASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLK TYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSD GFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKK GILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRI EEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRL SDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNY WRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHV AQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINN YHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEI GKATAKYFFYSNIMNFEKTEITLANGEIRKRPLIETNGETGEIVWDKGR DFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWD PKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEK NPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNE LALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQIS EFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAA FKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD.

Assignees

Inventors

Classifications

  • Fusion polypeptide · CPC title

  • Phosphorothioates · CPC title

  • 2'-O-R Modification · CPC title

  • Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; {Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing (when used in plants C12N15/8218)} · CPC title

  • Ribonucleases {[RNase]; Deoxyribonucleases [DNase]} · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US11142760B2 cover?
The present invention features compositions and methods for editing deleterious mutations associated with hemoglobinopathies, such as sickle cell disease (SCD). In particular embodiments, the invention provides methods for correcting mutations in a beta globin polynucleotide using modified adenosine base editors termed “ABE8” having unprecedented levels (e.g., >60-70%) of efficiency.
Who is the assignee on this patent?
Beam Therapeutics Inc
What technology area does this patent fall under?
Primary CPC classification C12N9/78. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Oct 12 2021 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 9 related publications on this page (citations in our corpus or others sharing the same primary CPC).