Di-enzymatic chimeric endolysin

US10975365B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-10975365-B2
Application numberUS-201916670194-A
CountryUS
Kind codeB2
Filing dateOct 31, 2019
Priority dateNov 5, 2018
Publication dateApr 13, 2021
Grant dateApr 13, 2021

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

A di-enzymatic chimeric endolysin includes a primary enzymatic active domain including a primary protein sequence and that cleaves a glycosidic, peptide, or amide bond; a secondary enzymatic active domain disposed at a C-terminus end of the di-enzymatic chimeric endolysin and including a secondary protein sequence that, in combination with the primary enzymatic active domain, synergistically cleaves glycosidic, peptide, or amide bonds in a peptidoglycan; a cell wall binding domain including a recognition sequence that is sequentially interposed between the primary protein sequence and the secondary protein sequence and that binds to a cell wall; and a tertiary structure such that the primary enzymatic active domain faces and opposes the secondary enzymatic active domain in the di-enzymatic chimeric endolysin for synergistic cleavage of the peptidoglycan.

First claim

Opening claim text (preview).

What is claimed is: 1. A di-enzymatic chimeric endolysin comprising: a primary enzymatic active domain disposed at an N-terminus end of the di-enzymatic chimeric endolysin, the primary enzymatic active domain comprising a primary protein sequence and that cleaves a glycosidic bond, a peptide bond, or an amide bond of a peptidoglycan in a cell wall of a cell; a secondary enzymatic active domain disposed at a C-terminus end of the di-enzymatic chimeric endolysin, the secondary enzymatic active domain comprising a secondary protein sequence and that, in combination with the primary enzymatic active domain, synergistically cleaves glycosidic bonds, peptide bonds, or amide bonds in the peptidoglycan in the cell wall; a cell wall binding domain: comprising a recognition sequence; chemically attached to the primary protein sequence and the secondary protein sequence, sequentially interposed between the primary protein sequence and the secondary protein sequence, and that binds to a cell wall; and a tertiary structure formed by folding of the primary protein sequence and the secondary protein sequence such that the primary enzymatic active domain faces and opposes the secondary enzymatic active domain in the di-enzymatic chimeric endolysin for synergistic cleavage of the peptidoglycan in the cell wall. 2. The di-enzymatic chimeric endolysin of claim 1 , further comprising a first linker interposed between the primary protein sequence and the recognition sequence. 3. The di-enzymatic chimeric endolysin of claim 2 , wherein the first linker comprises: (Sequence ID No. 4) TGDGKNPSVGTGNATVSASSE or (Sequence ID No. 5) TGDGKNPSVGTGNATVSASSECT. 4. The di-enzymatic chimeric endolysin of claim 1 , further comprising a second linker interposed between the secondary protein sequence and the recognition sequence. 5. The di-enzymatic chimeric endolysin of claim 4 , wherein the second linker comprises (Sequence ID No. 6) QTNPNPDKPTVKSPGQNDLGS or (Sequence ID No. 7) LQQTNPNPDKPTVKSPGQNDLGS. 6. The di-enzymatic chimeric endolysin of claim 1 , wherein the primary protein sequence comprises (Sequence ID No. 1) MSKKYTQQQYEKYLAQPANNTFGLSPQQVADWFMGQAGARPVINSYGVNAS NLVSTYIPKMQEYGVSYTLFLMYTVFEGGGAGNWINHYMYDTGSNGLECLE HDLQYIHGVWETYFPPALSAPECYPATEDNAGALDRFYQSLPGRTWGDVMI PSTMAGNAWVWAYNYCVNNQGAAPLVYFGNPYDSQIDSLLAMGADPFTGGS I, (Sequence ID No. 2) MVKKNDLFVDVSSHNGYDITGILEQMGTTNTIIKISESTTYLNPCLSAQVE QSNPIGFYHFARFGGDVAEAEREAQFFLDNVPMQVKYLVLDYEDDPSGDAQ ANTNACLRFMQMIADAGYKPIYYSYKPFTHDNVDYQQILAQFPNSLWIAGY GLNDGTANFEYFPSMDGIRWWQYSSNPFDKNIVLLDD, or (Sequence ID No. 3) MTTVNEALNNVRAQVGSGVSVGNGECYALASWYERMISPDATVGLGAGVGW VSGAIGDTISAKNIGSSYNWQANGWTVSTSGPFKAGQIVTLGATPGNPYGH VVIVEAVDGDRLTILEQNYGGKRYPVRNYYSAASYRQQVVHYIT. 7. The di-enzymatic chimeric endolysin of claim 1 , wherein the secondary protein sequence comprises (Sequence ID No. 8) GSDRVAANLANAQAQVGKYIGDGQCYAWVGWWSARVCGYSISYSTGDPMLP LIGDGMNAHSIHLGWDWSIANTGIVNYPVGTVGRKEDLRVGAIWCATAFSG APFYTGQYGHTGIIESWSDTTVTVLEQNILGSPVIRSTYDLNTFLSTLTGL ITFK or (Sequence ID No. 9) MVKKNDLFVDVSSHNGYDITGILEQMGTTNTIIKISESTTYLNPCLSAQVE QSNPIGFYHFARFGGDVAEAEREAQFFLDNVPMQVKYLVLDYEDDPSGDAQ ANTNACLRFMQMIADAGYKPIYYSYKPFTHDNVDYQQILAQFPNSLWIAGY GLNDGTANFEYFPSMDGIRWWQYSSNPFDKNIVLLDDEEDDKPKTAGTWKQ DSKGWWFRRNNGSFPY. 8. The di-enzymatic chimeric endolysin of claim 1 , wherein the recognition sequence comprises (Sequence ID No. 10) ANREKLKKALTDLFNNNLEHLSGEFYGNQVLNAMKYGTILKCDLTDDGLNA ILQLIADVNL,

Assignees

Inventors

Classifications

  • Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change · CPC title

  • Proteinases {, e.g. Endopeptidases (3.4.21-3.4.25)} · CPC title

  • Lysis of microorganisms · CPC title

  • Fusion polypeptide · CPC title

  • DNA sequences coding for fusion proteins · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US10975365B2 cover?
A di-enzymatic chimeric endolysin includes a primary enzymatic active domain including a primary protein sequence and that cleaves a glycosidic, peptide, or amide bond; a secondary enzymatic active domain disposed at a C-terminus end of the di-enzymatic chimeric endolysin and including a secondary protein sequence that, in combination with the primary enzymatic active domain, synergistically cl…
Who is the assignee on this patent?
Government Of The Us Secretary Of Commerce
What technology area does this patent fall under?
Primary CPC classification C12N9/2402. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Apr 13 2021 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).