Protein sequencing method and reagents
US-9566335-B1 · Feb 14, 2017 · US
US10836798B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10836798-B2 |
| Application number | US-201916395407-A |
| Country | US |
| Kind code | B2 |
| Filing date | Apr 26, 2019 |
| Priority date | Nov 8, 2018 |
| Publication date | Nov 17, 2020 |
| Grant date | Nov 17, 2020 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
An amino acid-specific binder selectively binds to a binding amino acid. A binder complex selectively identifies the binding amino acid and includes an adjunct attached to the amino acid-specific binder. The adjunct includes a taggant, protein, substrate, or chemical modifier. Selectively identifying an N-terminal amino acid includes anchoring a C-terminal end; contacting an N-terminal amino acid of the anchored analyte with the binder complex; selectively binding when the N-terminal amino acid includes the binding amino acid; producing, by the taggant of the tagged complex, a taggant signal; detecting the taggant signal; and identifying the N-terminal amino acid based on the taggant signal.
Opening claim text (preview).
What is claimed is: 1. An amino acid-specific binder for selectively binding to an amino acid in an analyte, the amino acid-specific binder comprising: a first amino acid sequence comprising (Sequence ID No. 1) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTCPSFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; a second amino acid sequence comprising (Sequence ID No. 2) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTCSWFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; a third amino acid sequence comprising (Sequence ID No. 3) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMSFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; a fourth amino acid sequence comprising (Sequence ID No. 4) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTSGRFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; a fifth amino acid sequence comprising (Sequence ID No. 5) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMPFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; a sixth amino acid sequence comprising (Sequence ID No. 6) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPREFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVSERDIAETKAKEATDLGKEAGFPLMFTTEP EE; a seventh amino acid sequence comprising (Sequence ID No. 7) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPREFVTEVLKAVFNMSE DQGRRVMMTAHRFGSAVVGVCTRDIAETKAKQATDLAREAGFPLMFTTEP EE; an eighth amino acid sequence comprising (Sequence ID No. 8) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMSFVTEVLKAVFNMSE DQGRRVMMTAHRFGSAVVGVSTRDIAETKAKQATDLAREAGFPLMFTTEP EE; or a ninth amino acid sequence comprising (Sequence ID No. 10) NLEKIKKLRNVIKEIKKDNIKEADEHEKKEREKETSAWKVILYNDDIHKF SYVTDVIVKVVGQISKAKAHTITVEAHSTGQALILSTWKSKAEKYCQELQ QNGLTVSIIHESQLKDKQKK. 2. An amino acid-specific binder for selectively binding to an amino acid in an analyte, the amino acid-specific binder comprising the amino acid sequence comprising: a first amino acid sequence comprising X1-C-P-S-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 1); a second amino acid sequence comprising X1-C-S-W-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 2); a third amino acid sequence comprising X1-P-M-S-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 3); a fourth amino acid sequence comprising X1-S-G-R-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 4); a fifth amino acid sequence comprising X1-P-M-P-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 5); a sixth amino acid sequence comprising X1-P-R-E-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 6); a seventh amino acid sequence comprising X1-P-R-E-X2-V-X3-R-X4-T-X5-S-E-X6-E-X7-G-K-X8 (Sequence ID No. 7); an eighth amino acid sequence comprising X1-P-M-S-X2-E-X3-N-X4-Q-X5-S-T-X6-Q-X7-A-R-X8 (Sequence ID No. 8); wherein: X1 comprises the amino acid sequence comprising SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYT (Sequence ID No. 20); X2 comprises the amino acid sequence comprising FVT; X3 comprises the amino acid sequence comprising VLKAVF (Sequence ID No. 22); X4 comprises the amino acid sequence comprising MSED (Sequence ID No. 23); X5 comprises the amino acid sequence comprising GRRVMMTAHRFGSAVVVV (Sequence ID No. 24); X6 comprises the amino acid sequence comprising RDIAETKAK (Sequence ID No. 25); X7 comprises the amino acid sequence comprising ATDL (Sequence ID No. 26); and X8 comprises the amino acid sequence comprising EAGFPLMFTTEPEE (Sequence ID No. 27), such that a total percentage amount of substitutions and deletions to X1, X2, X3, X4, X5, X6, X7, and X8 is from 0% to less than 30%, exclusive of (Sequence ID No. 27) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTCPSFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVC
sequencing · CPC title
Assays for specific amino acids · CPC title
Plasmodium · CPC title
from bacteria · CPC title
Labelling of peptides · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.