Chimeric proteins
US-2019309286-A1 · Oct 10, 2019 · US
US10818377B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10818377-B2 |
| Application number | US-201715813872-A |
| Country | US |
| Kind code | B2 |
| Filing date | Nov 15, 2017 |
| Priority date | Nov 16, 2016 |
| Publication date | Oct 27, 2020 |
| Grant date | Oct 27, 2020 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
Described herein are polypeptides capable of self-assembling to form homo-oligomers, and methods for designing such polypeptides.
Opening claim text (preview).
We claim: 1. An isolated polypeptide comprising the amino acid sequence that has at least 70% sequence identity to the amino acid sequence of SEQ ID NO: 40, wherein the polypeptide is capable of self-assembly into homo-oligomers. 2. The isolated polypeptide of claim 1 , wherein the polypeptide comprises the amino acid sequence having at least 75% sequence identity to the amino acid sequence of SEQ ID NO: 40. 3. The isolated polypeptide of claim 1 , wherein the polypeptide comprises the amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 40. 4. The isolated polypeptide of claim 1 , wherein the polypeptide comprises the amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 40. 5. The isolated polypeptide of claim 1 , wherein the polypeptide comprises the amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 40. 6. The polypeptide of claim 1 , wherein the polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NOS: 16-21, 34-35, 37, and 40. 7. The isolated polypeptide of claim 1 , wherein the polypeptide comprises the amino acid sequence of SEQ ID NO: 40. 8. The isolated polypeptide of claim 1 , wherein residues in bold font for SEQ ID NO: 40 are conserved in the polypeptide EEAELAYLLGELAYKLGEYRIAIRAYRIALKRDPNNAEAWYNLGNAYYKQGRYREAIEYYQKAL ELDPNNAEAWYNLGNAYYERGEYEEAIEYYRKALRLDPNNADAMQNLLNAKMREE (SEQ ID NO: 40). 9. An isolated polypeptide homo-oligomer comprising a plurality of polypeptides according to claim 8 . 10. The isolated polypeptide homo-oligomer of claim 9 , further comprising a plurality of polypeptides having at least 97% sequence identity to the amino acid sequence of SEQ ID NO: 39. 11. An isolated polypeptide homo-oligomer comprising a plurality of polypeptides according to claim 1 . 12. The isolated polypeptide homo-oligomer of claim 11 , further comprising a plurality of polypeptides having at least 97% sequence identity to the amino acid sequence of SEQ ID NO: 39. 13. The isolated polypeptide oligomer of claim 12 , wherein residues in bold font for SEQ ID NO: 39 are conserved (SEQ ID NO: 39) KYDGSKLRIGIL H A R W NAE II L AL VL GA L KRL Q EFGVK R ENII IET VPGSF ELPYGSKLFVEKQKRLGKPLDAIIPIGVLIKGSTMHFEYICDSTTHQLMKL NFELGIPVIFGVLTCLTDEQAEARAGLIEGKMHNHGEDWGAAAVEMATKF N.
Peptides having up to 20 amino acids in an undefined or only partially defined sequence; Derivatives thereof · CPC title
ICT specially adapted for modelling or simulations in systems biology, e.g. gene-regulatory networks, protein interaction networks or metabolic networks · CPC title
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof · CPC title
Drug targeting using structural data; Docking or binding prediction · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.