Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule

US10752668B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-10752668-B2
Application numberUS-201515327517-A
CountryUS
Kind codeB2
Filing dateJul 24, 2015
Priority dateJul 25, 2014
Publication dateAug 25, 2020
Grant dateAug 25, 2020

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The invention relates to the regulated expression of a chimeric antigen receptor (CAR) within a lentiviral vector. The CAR comprises a hook-binding domain that interacts with a hook, preferably encoded by the same lentiviral vector, which prevents proper processing and release of the CAR to the cell membrane. The invention encompasses vectors, methods of making the vectors, and methods of using them, including medicinal uses. The vectors can be used for administration to humans to induce immune responses and to treat cancers and tumors.

First claim

Opening claim text (preview).

We claim: 1. A chimeric antigen receptor comprising: a binding domain; a transmembrane domain; a hook-binding domain comprising a streptavidin-binding peptide; and an activation domain comprising a T cell activating fragment comprising an amino acid sequence having at least 90% amino acid sequence identity to the amino acid sequence selected from the group consisting of: the amino acid fragment of sequence PKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYD VLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKG HDGLY from SEQ ID NO:3; SEQ ID NO:4; the amino acid fragment of sequence KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL from SEQ ID NO:5; SEQ ID NO:6; SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:33, and SEQ ID NO:34, the hook-binding domain being encoded by the nucleic acid sequence SEQ ID NO:2; the hook-binding domain being located in the intracytoplasmic region, between the transmembrane domain and the activation domain, between two activation domains or at the intracytoplasmic C-terminus of the chimeric antigen receptor; the binding domain being located in the extracytoplasmic region of the chimeric antigen receptor; and the T cell activating fragment being located in the intracytoplasmic region of the chimeric antigen receptor. 2. The chimeric antigen receptor of claim 1 , wherein the binding domain comprises a single-chain Fv antibody or a nanobody. 3. The chimeric antigen receptor of claim 1 , wherein the chimeric antigen receptor comprises the amino acid sequence of any of SEQ ID NO:46, SEQ ID NO:48, or SEQ ID NO:50. 4. The chimeric antigen receptor of claim 1 , wherein the activation domain comprises a T cell activating fragment comprising the amino acid sequence selected from the group consisting of: the amino acid fragment of sequence PKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEY DVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRG KGHDGLY from SEQ ID NO:3; SEQ ID NO:4; the amino acid fragment of sequence KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL from SEQ ID NO:5; SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:33, and SEQ ID NO:34. 5. The chimeric antigen receptor of claim 1 , wherein the activation domain comprises the amino acid fragment of sequence KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL from the amino acid sequence SEQ ID NO:5 and the amino acid fragment of sequence PKLCYLLD GILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEY DVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRG KGHDGLY from the amino acid sequence SEQ ID NO:3.

Assignees

Inventors

Classifications

  • CD19 or B4 · CPC title

  • Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4 · CPC title

  • Chimeric antigen receptors [CAR] · CPC title

  • T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells · CPC title

  • On/off switch · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US10752668B2 cover?
The invention relates to the regulated expression of a chimeric antigen receptor (CAR) within a lentiviral vector. The CAR comprises a hook-binding domain that interacts with a hook, preferably encoded by the same lentiviral vector, which prevents proper processing and release of the CAR to the cell membrane. The invention encompasses vectors, methods of making the vectors, and methods of using…
Who is the assignee on this patent?
Theravectys, Inst Curie, Centre Nat Rech Scient, and 3 more
What technology area does this patent fall under?
Primary CPC classification C07K14/70503. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Aug 25 2020 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 3 related publications on this page (citations in our corpus or others sharing the same primary CPC).