Tagged chimeric effector molecules and receptors thereof
US-10494434-B2 · Dec 3, 2019 · US
US10752668B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10752668-B2 |
| Application number | US-201515327517-A |
| Country | US |
| Kind code | B2 |
| Filing date | Jul 24, 2015 |
| Priority date | Jul 25, 2014 |
| Publication date | Aug 25, 2020 |
| Grant date | Aug 25, 2020 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
The invention relates to the regulated expression of a chimeric antigen receptor (CAR) within a lentiviral vector. The CAR comprises a hook-binding domain that interacts with a hook, preferably encoded by the same lentiviral vector, which prevents proper processing and release of the CAR to the cell membrane. The invention encompasses vectors, methods of making the vectors, and methods of using them, including medicinal uses. The vectors can be used for administration to humans to induce immune responses and to treat cancers and tumors.
Opening claim text (preview).
We claim: 1. A chimeric antigen receptor comprising: a binding domain; a transmembrane domain; a hook-binding domain comprising a streptavidin-binding peptide; and an activation domain comprising a T cell activating fragment comprising an amino acid sequence having at least 90% amino acid sequence identity to the amino acid sequence selected from the group consisting of: the amino acid fragment of sequence PKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYD VLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKG HDGLY from SEQ ID NO:3; SEQ ID NO:4; the amino acid fragment of sequence KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL from SEQ ID NO:5; SEQ ID NO:6; SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:33, and SEQ ID NO:34, the hook-binding domain being encoded by the nucleic acid sequence SEQ ID NO:2; the hook-binding domain being located in the intracytoplasmic region, between the transmembrane domain and the activation domain, between two activation domains or at the intracytoplasmic C-terminus of the chimeric antigen receptor; the binding domain being located in the extracytoplasmic region of the chimeric antigen receptor; and the T cell activating fragment being located in the intracytoplasmic region of the chimeric antigen receptor. 2. The chimeric antigen receptor of claim 1 , wherein the binding domain comprises a single-chain Fv antibody or a nanobody. 3. The chimeric antigen receptor of claim 1 , wherein the chimeric antigen receptor comprises the amino acid sequence of any of SEQ ID NO:46, SEQ ID NO:48, or SEQ ID NO:50. 4. The chimeric antigen receptor of claim 1 , wherein the activation domain comprises a T cell activating fragment comprising the amino acid sequence selected from the group consisting of: the amino acid fragment of sequence PKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEY DVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRG KGHDGLY from SEQ ID NO:3; SEQ ID NO:4; the amino acid fragment of sequence KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL from SEQ ID NO:5; SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:33, and SEQ ID NO:34. 5. The chimeric antigen receptor of claim 1 , wherein the activation domain comprises the amino acid fragment of sequence KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL from the amino acid sequence SEQ ID NO:5 and the amino acid fragment of sequence PKLCYLLD GILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEY DVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRG KGHDGLY from the amino acid sequence SEQ ID NO:3.
CD19 or B4 · CPC title
Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4 · CPC title
Chimeric antigen receptors [CAR] · CPC title
T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells · CPC title
On/off switch · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.