Tissue-directed antibodies and methods of using the same
US-2024342260-A1 · Oct 17, 2024 · US
US10689441B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10689441-B2 |
| Application number | US-201414563112-A |
| Country | US |
| Kind code | B2 |
| Filing date | Dec 8, 2014 |
| Priority date | Dec 6, 2013 |
| Publication date | Jun 23, 2020 |
| Grant date | Jun 23, 2020 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
This invention relates generally to anti-Toll-like Receptor 4 (TLR4 antagonists) including antibodies that specifically bind Toll-like Receptor 4 (TLR-4), to methods of using the anti-TLR4 antagonists as therapeutics and to methods of using the anti-TLR4 antagonists for inhibiting, delaying the progression of, or otherwise ameliorating a symptom of Graft-versus-Host disease (GvHD) and/or improving survival of GvHD subjects and/or transplanted biological materials in subjects.
Opening claim text (preview).
What is claimed is: 1. A method of preventing or reducing the likelihood of Graft-versus-Host disease (GvHD) in a human subject in need of an allogeneic stem cell transplant comprising: (i) contacting a stem cell population that is allogeneic to said human subject with an antibody or immunologically active fragment thereof that specifically binds a human Toll-like receptor 4 (TLR4) polypeptide comprising a variable heavy chain complementarity determining region 1 (V H CDR1) comprising the amino acid sequence of GGYSWH (SEQ ID NO: 1); a V H CDR2 region comprising the amino acid sequence of YIHYSGYTDFNPSLKT (SEQ ID NO: 2); a V H CDR3 region comprising the amino acid sequence of KDPSDAFPY (SEQ ID NO: 3); a variable light chain complementarity determining region 1 (V L CDR1) region comprising the amino acid sequence of RASQSISDHLH (SEQ ID NO: 4); a V L CDR2 region comprising the amino acid sequence of YASHAIS (SEQ ID NO: 5); and a V L CDR3 region comprising the amino acid sequence of QQGHSFPLT (SEQ ID NO: 6), to produce a transplantable composition; and (ii) implanting the transplantable composition at a desired location in the subject. 2. The method of claim 1 , further comprising: (iii) administering to the subject one or more doses of the antibody or immunologically active fragment thereof of step (i) in an amount sufficient to prevent or reduce the likelihood of GvHD in said human subject. 3. The method of claim 1 or 2 , wherein allogeneic stem cell transplant is a bone marrow derived stem cell transplant or hematopoietic stem cell transplant. 4. The method of claim 2 , where the antibody or immunologically active fragment thereof that specifically binds TLR4 in steps (i) and (iii) are the same antibody or immunologically active fragment. 5. The method of claim 2 , where the antibody or immunologically active fragment thereof that specifically binds TLR4 in step (i) and the antibody or immunologically active fragment thereof that specifically binds TLR4 in step (iii) are different antibodies or immunologically active fragments. 6. The method of claim 2 , wherein the antibody or immunologically active fragment thereof that specifically binds TLR4 is administered in step (iii) in combination with one or more additional agents. 7. The method of claim 6 , wherein the one or more additional agents is one or more immunosuppressive agents. 8. The method of claim 6 , wherein the one or more additional agents is selected from methotrexate, cyclosporin A, tacrolimus, sirolimus, everolimus, a corticosteroid, anti-thymocyte globulin, Infliximab, Etanercept and Adalimumab. 9. The method of claim 1 or 2 , wherein the antibody or immunologically active fragment thereof that binds TLR4 is a mouse monoclonal antibody, a chimeric monoclonal antibody, a humanized monoclonal antibody, a fully human monoclonal antibody, a domain antibody, a single chain antibody, a F ab fragment, a F ab′ fragment, a F (ab′)2 fragment, an scFv or an F ab expression library. 10. The method of claim 1 or 2 , wherein the antibody or immunologically active fragment thereof that binds TLR4 further comprises a heavy chain variable amino acid sequence of QVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIRQPPGKGLEWMGYIHYSGYT DFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCARKDPSDAFPYWGQGTLVTVSS (SEQ ID NO: 7) and a light chain variable amino acid sequence of EIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPDQSPKLLIKYASHAISGVPSR FSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGTKVEIK (SEQ ID NO: 8). 11. The method of claim 1 or 2 , wherein the antibody or immunologically active fragment thereof that binds TLR4 further comprises a heavy chain amino acid sequence of MGWSWIFLFLLSGTAGVHCQVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIR QPPGKGLEWMGYIHYSGYTDFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCAR KDPSDAFPYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSSKAFPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 9) and a light chain amino acid sequence of MEWSWVFLFFLSVTTGVHSEIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPD QSPKLLIKYASHAISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGT KVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 10). 12. A method of preventing or reducing the likelihood of GvHD in a human subject who has received or will receive an allogeneic stem cell transplant comprising administering to the subject one or more doses of an antibody or immunologically an antibody or immunologically active fragment thereof that specifically binds a human Toll-like receptor 4 (TLR4) polypeptide comprising a variable heavy chain complementarity determining region 1 (V H CDR1) comprising the amino acid sequence of GGYSWH (SEQ ID NO: 1); a V H CDR2 region comprising the amino acid sequence of YIHYSGYTDFNPSLKT (SEQ ID NO: 2); a V H CDR3 region comprising the amino acid sequence of KDPSDAFPY (SEQ ID NO: 3); a variable light chain complementarity determining region 1 (V L CDR1) region comprising the amino acid sequence of RASQSISDHLH (SEQ ID NO: 4); a V L CDR2 region comprising the amino acid sequence of YASHAIS (SEQ ID NO: 5); and a V L CDR3 region comprising the amino acid sequence of QQGHSFPLT (SEQ ID NO: 6) in an amount sufficient to prevent or reduce the likelihood of GvHD in said human subject. 13. The method of claim 12 , wherein allogeneic stem cell transplant is a bone marrow derived stem cell transplant or hematopoietic stem cell transplant. 14. The method of claim 12 , wherein the antibody or immunologically active fragment thereof that specifically binds TLR4 is administered in combination with one or more additional agents. 15. The method of claim 14 , wherein the one or more additional agents is one or more immunosuppressive agents. 16. The method of claim 15 , wherein the one or more additional agents is selected from methotrexate, cyclosporin A, tacrolimus, sirolimus, everolimus, a corticosteroid, anti-thymocyte globulin, Infliximab, Etanercept and Adalimumab. 17. The method of claim 12 , wherein the antibody or immunologically active fragment thereof that binds TLR4 is a mouse monoclonal antibody, a chimeric monoclonal antibody, a humanized monoclonal antibody, a fully human monoclonal antibody, a domain antibody, a single chain antibody, a F ab fragment, a F ab′ fragment, a F (ab′)2 fragment, an scFv or an F ab expression library. 18. The method of claim 12 , wherein the antibody or immunologically active fragment thereof that binds TLR4 further comprises the heavy chain variable amino acid sequence QVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIRQPPGKGLEWMGYIHYSGYT DFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCARKDPSDAFPYWGQGTLVTVSS (SEQ ID NO: 7) and the light chain variable amino acid sequence EIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPDQSPKLLIKYASHAISGVPSR FSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGTKVEIK (SEQ ID NO: 8). 19. The method of claim 12 , wherein the antibody or immunologically active fragment thereof that binds TLR4 further comprises the heavy chain amino acid sequence MGWSWIFLFLLSGTAGVHCQVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIR QPPGKGLEWMGYIHYSGYTDFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCAR KDPSDAFPYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV
against molecules with a "CD"-designation, not provided for elsewhere · CPC title
Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity · CPC title
Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues · CPC title
Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells · CPC title
Antagonist effect on antigen, e.g. neutralization or inhibition of binding · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.