Tissue-directed antibodies and methods of using the same
US-2024342260-A1 · Oct 17, 2024 · US
US10556960B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10556960-B2 |
| Application number | US-201715632882-A |
| Country | US |
| Kind code | B2 |
| Filing date | Jun 26, 2017 |
| Priority date | Oct 22, 2013 |
| Publication date | Feb 11, 2020 |
| Grant date | Feb 11, 2020 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
This invention relates generally to methods and compositions for diagnosing and treating disorders associated with elevated levels of Toll-like Receptor 4 (TLR4) ligands and other biomarkers. The invention also relates to methods of treating, delaying the progression of, or otherwise ameliorating a symptom of a disorder associated with elevated levels of TLR4 ligands and other biomarkers using agents that interfere with or otherwise antagonize TLR4 signaling, including neutralizing anti-TLR4 antibodies.
Opening claim text (preview).
What is claimed is: 1. A method of alleviating a symptom in a subject having a disorder associated with excessive aberrant TLR4 signaling or elevated TLR4 ligand expression or activity, the method comprising: a) identifying a subject having an elevated level of expression of citrullinated fibrinogen and citrullinated histone 2b compared to a control level of expression; and b) administering an anti-TLR4 antibody or an immunologically active fragment thereof that binds and neutralizes TLR4, in an amount sufficient to alleviate the symptom of the disorder. 2. The method of claim 1 , further comprising detecting the level of an anti-citrullinated protein antibody (ACPA), a citrullinated fibrin, a citrullinated vimentin, a citrullinated enolase, a citrullinated chemokine, HMGB1, S100A8/A9, Tenascin C, or combinations thereof. 3. The method of claim 2 , wherein the citrullinated chemokine is citrullinated CXCL10. 4. The method of claim 1 , wherein the citrullinated fibrinogen and/or the citrullinated histone 2b is in an immune complex. 5. The method of claim 4 , wherein the citrullinated fibrinogen and/or the citrullinated histone 2b is in an immune complex with an IgG protein. 6. The method of claim 1 , wherein the biological sample is or is derived from blood. 7. The method of claim 1 , wherein the biological sample is or is derived from urine. 8. The method of claim 1 , wherein the biological sample is or is derived from synovial fluid. 9. The method of claim 1 , wherein the anti-TLR4 antibody or immunologically active fragment thereof comprises a variable heavy chain complementarity determining region 1 (VH CDR1) the amino acid sequence of GGYSWH (SEQ ID NO: 1); a VH CDR2 region comprising the amino acid sequence of YIHYSGYTDFNPSLKT (SEQ ID NO: 2); a VH CDR3 region comprising the amino acid sequence of KDPSDAFPY (SEQ ID NO: 3); a variable light chain complementarity determining region 1 (VL CDR1) region comprising the amino acid sequence of RASQSISDHLH (SEQ ID NO: 4); a VL CDR2 region comprising the amino acid sequence of YASHAIS (SEQ ID NO: 5); and a VL CDR3 region comprising the amino acid sequence of QQGHSFPLT (SEQ ID NO: 6). 10. The method of claim 9 , wherein the anti-TLR4 antibody or immunologically active fragment thereof comprises the heavy chain variable amino acid sequence QVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIRQPPGKGLEWMGYIHYSGYT DFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCARKDPSDAFPYWGQGTLVTVSS (SEQ ID NO: 7) and the light chain variable amino acid sequence EIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPDQSPKLLIKYASHAISGVPSR FSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGTKVEIK (SEQ ID NO: 8). 11. The method of claim 10 , wherein the anti-TLR4 antibody or immunologically active fragment thereof comprises the heavy chain amino acid sequence MGWSWIFLFLLSGTAGVHCQVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIR QPPGKGLEWMGYIHYSGYTDFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCAR KDPSDAFPYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSSKAFPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 9) and the light chain amino acid sequence MEWSWVFLFFLSVTTGVHSEIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPD QSPKLLIKYASHAISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGT KVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 10). 12. The method of claim 1 , wherein the subject is human. 13. The method of claim 1 , wherein the disorder is an autoimmune or inflammatory disorder. 14. The method of claim 1 , wherein the disorder is rheumatoid arthritis (RA). 15. The method of claim 1 , wherein the disorder is atherosclerosis. 16. The method of claim 1 , wherein the disorder is associated with organ or tissue transplantation. 17. The method of claim 1 , wherein the disorder is associated with acute lung injury. 18. The method of claim 1 , wherein the disorder is associated with ischemia/reperfusion injury.
Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00 · CPC title
Antiallergic agents (antiasthmatic agents A61P11/06; ophthalmic antiallergics A61P27/14) · CPC title
Immunosuppressants, e.g. drugs for graft rejection · CPC title
Immunomodulators · CPC title
for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.